KEGG   Aspergillus nidulans: AN6576.2Help
Entry
AN6576.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ani  Aspergillus nidulans
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ani00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 178 aa AA seqDB search
MKAYWYDNKPGDQREPHDSGRPVSEDYLASLGVIYRHFPELSDVDALAKERGYKNRDEIT
VSPATMGEAYEDKVKMFFAEHLHEDEEIRYIRDGEGYFDVRGKEDEWVRIRLVKDDLIIL
PAGIYHRFTTDNKNYIKAMRLFQEEPKWTPLNRAPELDENQHRKSYLEGLTATSIAAN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctactggtacgacaacaagcccggcgaccagcgcgaaccccacgactccggc
cgccccgtctcagaagactaccttgcctctctcggcgtaatctaccgccacttcccagag
ctttcggatgtcgacgcgctcgccaaggaacgcggctacaagaaccgcgatgagatcacc
gtctcccccgcaacaatgggcgaggcttacgaggataaggtgaagatgttcttcgccgag
catctgcacgaggacgaggaaatccggtatatccgtgacggagagggatattttgatgtg
cgggggaaagaagacgagtgggtgcgcattcgacttgtcaaggatgatctgattatcctc
cccgcgggtatttatcaccgatttacgaccgataataaaaattacatcaaggcgatgcga
ctgttccaggaggagcctaagtggacgccattgaaccgtgcaccggagcttgatgagaac
cagcaccggaagtcttacctagagggactcactgctacctcaattgctgcgaactag

DBGET integrated database retrieval system