KEGG   Aspergillus nidulans: AN6653.2Help
Entry
AN6653.2          CDS       T01016                                 

Definition
MASY_EMENI Malate synthase, glyoxysomal
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ani  Aspergillus nidulans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AN6653.2
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AN6653.2
   00630 Glyoxylate and dicarboxylate metabolism
    AN6653.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AN6653.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 528 aa AA seqDB search
MSQVDAQLKDVAILGSVSNEARKILTKEACAFLAILHRTFNPTRKALLQRRVDRQAEIDK
GHLPDFLPETKHIRDDPSWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVAPTWDNMI
NGQINLYDAIRRQVDFKQGQKEYKLRTDRTLPTLIARARGWHLDEKHFTVDGEPISGSLF
DFGLYFFHNAKELVARGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGMPRGTIRGTVLI
ETITAAFEMEEIIYELRDHSSGLNCGRWDYIFSFIKKFRQHPNFVLPDRSDVTMTVPFMD
AYVKLLIKTCHKRGVHAMGGMAAQIPIKDNAEANDKAMEGVRADKLREVRAGHDGTWVAH
PALASIASEVFNKYMPTPNQMHVRREDVNITANDLLNTNVPGKITEDGIRKNLNIGLSYM
EGWLRGVGCIPINYLMEDAATAEVSRSQLWQWARHGVTTSEGKKVDKAYALRLLKEQADA
LAAKGPKGNKFQLAGRYFAGQVTGEDYADFLTSLLYNEISSPGTASKL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggtcgacgcccagcttaaggatgtggccatcctcggctccgtgagcaacgaa
gcccgcaagatcctcacaaaggaagcctgtgctttcctcgccatcttacaccgtaccttc
aaccctactcgcaaggctctcctgcagcgccgcgttgatcgtcaggccgagatcgacaag
ggccacctccccgacttcctcccagagaccaagcacatccgcgatgatcccagctggaag
ggagctcccccagcgcctggtctcgtcgaccgtcgcgttgagatcactggtcctaccgac
cggaagatggtcgtcaacgcactgaactcggatgtcgcccctacttgggataacatgatc
aacggccagatcaacctttacgatgccatccgccgccaggtcgacttcaagcagggtcag
aaggagtacaagcttcgcacagaccgaaccctgcccaccctgattgctcgtgcccgtggc
tggcacctcgacgagaagcacttcactgtcgatggcgagcccatctccggcagtctgttc
gactttggtctgtacttcttccacaacgccaaggaattggtggctcgcgggttcggtcct
tacttctaccttcccaagatggagtctcacctcgaagctcgtctgtggaacgatgtcttc
aacctggctcaggactacattggcatgccccgcggcaccatccgtggtaccgttctgatt
gaaaccatcactgctgcgtttgagatggaagagatcatctacgaactccgtgaccacagc
tccggtctcaactgcggccgctgggactacatcttctccttcatcaagaaattccgccaa
caccccaactttgtccttcctgaccgctctgatgtcaccatgaccgtacctttcatggat
gcctacgtgaagctcctcatcaagacctgtcacaagcgaggagtccacgctatgggtgga
atggccgctcaaatccccattaaagacaacgccgaggccaacgacaaggccatggaaggc
gtgcgcgccgataagctccgtgaagttcgtgcaggccacgacggcacatgggttgcgcac
ccggctctcgcttcgattgccagtgaagttttcaacaagtacatgcccacccccaatcag
atgcacgtccgccgcgaggacgtcaacatcaccgccaacgacctcctcaacaccaacgtt
cccggaaagatcaccgaggacggtatccgcaagaacctgaacatcggtctctcctacatg
gagggttggcttcgtggtgtcggatgtatccctattaactacctgatggaggacgccgct
accgccgaagtctcccgcagccagctttggcaatgggcccgccacggtgttaccacctct
gagggcaagaaggttgacaaggcttatgccttacgtctgctgaaggaacaggccgatgcc
cttgcagccaagggtcctaagggcaacaagttccagcttgctggtcgctactttgccggc
caggttaccggtgaagattacgccgacttcttgaccagcctgctgtacaacgagatttcg
tctccgggtactgcttcaaagctctaa

DBGET integrated database retrieval system