KEGG   Aspergillus nidulans: AN6708.2Help
Entry
AN6708.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AN6708.2
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN6708.2
   00020 Citrate cycle (TCA cycle)
    AN6708.2
   00620 Pyruvate metabolism
    AN6708.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AN6708.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 488 aa AA seqDB search
MVASAVRMRVPSASFISKGACSLRRPQASYKFTAAIQHQLPALAALSRYYASKSFPPHTI
ISMPALSPTMTAGNIGAWQKKAGDALQPGDVLVEIETDKAQMDFEFQEEGILAKVLKESG
EKDVSVGSPIAVLVEEGTDVAAFESFSLEDAGGEGAGAAPPKETQETPKEAPKASEPSTP
QPAAGAYEPDTSGEKLQPSLDREPAISPAAKALALEKGVPIKALKGTGRGGQITKEDVEK
YKPTAAAAAAGPASEDIPLTSMRKTIASRLQQSWNQNPHFFVSTTLSVTKLLKLRQALNA
SSEGKYKLSVNDFLIKACAAALRKVPQVNSSWTEENGQVVIRQHNSVDISVAVATPVGLI
TPIVKNAQGLGLSSISNQVKDLGKRARDNKLKPEEYQGGTFTISNMGMNPAVERFTAIIN
PPQAGILAVGTTRKVAVPVETEEGTSVEWDDQIIVTASFDHRVVDGAVGAEWIKELKKVV
ENPLELLL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcctctgctgtcagaatgcgcgtccccagcgcttcattcatctcaaaaggtgcc
tgctccttaaggcgaccacaagcctcttacaaattcacggctgctatccaacatcaattg
cctgctttagctgctctttcacgttactacgcctccaagtctttccctcctcacactatc
atcagcatgcctgccctgtcgccaacaatgacggcaggaaacattggagcgtggcagaag
aaagctggtgatgctttgcaacctggcgatgttctggttgagattgagaccgataaggcg
cagatggactttgagttccaagaggagggtatcttggccaaggtgctgaaggaatctggc
gagaaagatgtgtctgttggctctcctattgctgtcctagttgaagagggcaccgacgtc
gcggcttttgaatcgttcagcttggaagatgctggtggcgagggtgctggtgccgctcct
ccaaaagaaactcaagaaactcctaaggaagcccctaaggcttcagagccatctacgccc
cagcctgctgctggtgcttatgagcccgatacctccggtgagaagctccagcctagtctg
gaccgcgaacctgcgatcagcccggctgctaaggctttggctcttgagaagggtgtgcca
atcaaggctctaaagggtaccggccggggtggccagattaccaaggaggatgttgagaag
tacaagcctactgctgcggctgcggctgctgggcctgcttctgaggacattcctctcaca
tcaatgcgcaagacgattgctagccgcctccagcagtcttggaaccagaaccctcacttt
ttcgtttctactactctgtccgtcaccaagcttctgaagcttcggcaggcactaaacgcc
tcctctgagggcaagtacaagctctccgtcaatgacttcctcatcaaggcttgcgctgcc
gctctccgcaaggttccccaggtgaactccagctggactgaggagaacggccaggttgtt
attcgccagcacaacagcgttgacatcagcgttgctgttgctacgcccgttggtctgatc
actcctattgtgaagaatgcccagggtcttggtctttccagcatttctaaccaggtcaag
gaccttggcaagcgtgctcgtgacaacaagctcaagcccgaagagtaccagggcggtact
ttcaccatcagcaacatgggcatgaaccctgctgttgagcgcttcaccgctatcatcaac
ccccctcaggctggtatcctcgctgttggcactacccgcaaggttgccgtccctgttgag
accgaagagggtacctcagttgagtgggatgatcagattatcgtaaccgctagcttcgat
caccgggttgttgacggtgctgtcggtgctgagtggatcaaggaactcaagaaggttgtc
gagaaccctctggaactccttctatag

DBGET integrated database retrieval system