KEGG   Aspergillus nidulans: AN6708.2Help
Entry
AN6708.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ani  Aspergillus nidulans
Pathway
ani00010  Glycolysis / Gluconeogenesis
ani00020  Citrate cycle (TCA cycle)
ani00620  Pyruvate metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN6708.2
   00020 Citrate cycle (TCA cycle)
    AN6708.2
   00620 Pyruvate metabolism
    AN6708.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AN6708.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF421
Motif
Other DBs
NCBI-GeneID: 2870361
NCBI-ProteinID: XP_664312
UniProt: Q5AYC2 A0A1U8QUD3
Position
I
AA seq 488 aa AA seqDB search
MVASAVRMRVPSASFISKGACSLRRPQASYKFTAAIQHQLPALAALSRYYASKSFPPHTI
ISMPALSPTMTAGNIGAWQKKAGDALQPGDVLVEIETDKAQMDFEFQEEGILAKVLKESG
EKDVSVGSPIAVLVEEGTDVAAFESFSLEDAGGEGAGAAPPKETQETPKEAPKASEPSTP
QPAAGAYEPDTSGEKLQPSLDREPAISPAAKALALEKGVPIKALKGTGRGGQITKEDVEK
YKPTAAAAAAGPASEDIPLTSMRKTIASRLQQSWNQNPHFFVSTTLSVTKLLKLRQALNA
SSEGKYKLSVNDFLIKACAAALRKVPQVNSSWTEENGQVVIRQHNSVDISVAVATPVGLI
TPIVKNAQGLGLSSISNQVKDLGKRARDNKLKPEEYQGGTFTISNMGMNPAVERFTAIIN
PPQAGILAVGTTRKVAVPVETEEGTSVEWDDQIIVTASFDHRVVDGAVGAEWIKELKKVV
ENPLELLL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcctctgctgtcagaatgcgcgtccccagcgcttcattcatctcaaaaggtgcc
tgctccttaaggcgaccacaagcctcttacaaattcacggctgctatccaacatcaattg
cctgctttagctgctctttcacgttactacgcctccaagtctttccctcctcacactatc
atcagcatgcctgccctgtcgccaacaatgacggcaggaaacattggagcgtggcagaag
aaagctggtgatgctttgcaacctggcgatgttctggttgagattgagaccgataaggcg
cagatggactttgagttccaagaggagggtatcttggccaaggtgctgaaggaatctggc
gagaaagatgtgtctgttggctctcctattgctgtcctagttgaagagggcaccgacgtc
gcggcttttgaatcgttcagcttggaagatgctggtggcgagggtgctggtgccgctcct
ccaaaagaaactcaagaaactcctaaggaagcccctaaggcttcagagccatctacgccc
cagcctgctgctggtgcttatgagcccgatacctccggtgagaagctccagcctagtctg
gaccgcgaacctgcgatcagcccggctgctaaggctttggctcttgagaagggtgtgcca
atcaaggctctaaagggtaccggccggggtggccagattaccaaggaggatgttgagaag
tacaagcctactgctgcggctgcggctgctgggcctgcttctgaggacattcctctcaca
tcaatgcgcaagacgattgctagccgcctccagcagtcttggaaccagaaccctcacttt
ttcgtttctactactctgtccgtcaccaagcttctgaagcttcggcaggcactaaacgcc
tcctctgagggcaagtacaagctctccgtcaatgacttcctcatcaaggcttgcgctgcc
gctctccgcaaggttccccaggtgaactccagctggactgaggagaacggccaggttgtt
attcgccagcacaacagcgttgacatcagcgttgctgttgctacgcccgttggtctgatc
actcctattgtgaagaatgcccagggtcttggtctttccagcatttctaaccaggtcaag
gaccttggcaagcgtgctcgtgacaacaagctcaagcccgaagagtaccagggcggtact
ttcaccatcagcaacatgggcatgaaccctgctgttgagcgcttcaccgctatcatcaac
ccccctcaggctggtatcctcgctgttggcactacccgcaaggttgccgtccctgttgag
accgaagagggtacctcagttgagtgggatgatcagattatcgtaaccgctagcttcgat
caccgggttgttgacggtgctgtcggtgctgagtggatcaaggaactcaagaaggttgtc
gagaaccctctggaactccttctatag

DBGET integrated database retrieval system