KEGG   Aspergillus nidulans: AN6835.2Help
Entry
AN6835.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ani00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ani00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1083 aa AA seqDB search
MAEIPEPKGLPLIGNIGTIDQEFPLGSMVALAEEHGEIYRLRFPGRTVVVVSTHALVNET
CDEKRFRKSVNSALAHVREGVHDGLFTAKMGEVNWEIAHRVLMPAFGPLSIRGMFDEMHD
IASQLALKWARYGPDCPIMVTDDFTRLTLDTLALCSMGYRFNSYYSPVLHPFIEAMGDFL
TEAGEKPRRPPLPAVFFRNRDQKFQDDIAVLRDTAQGVLQARKEGKSDRNDLLSAMLRGV
DSQTGQKMTDESIMDNLITFLIAGHETTSGLLSFVFYQLLKHPETYRTAQQEVDNVVGQG
VIEVSHLSKLPYINSVLRETLRLNATIPLFTVEAFEDTLLAGKYPVKAGETIVNLLAKSH
LDPEVYGEDALEFKPERMSDELFNARLKQFPSAWKPFGNGMRACIGRPFAWQEALLVMAM
LLQNFDFSLADPNYDLKFKQTLTIKPKDMFMKARLRHGLTPTTLERRLAGLAVESATQDK
IVTNPADNSVTGTRLTILYGSNSGTCETLARRIAADAPSKGFHVMRFDGLDSGRSALPTD
HPVVIVTSSYEGQPPENAKQFVSWLEELEQQNESLQLKGVDFAVFGCFKEWAQTFHRIPK
LVDSLLEKLGGSRLTDLGLADVSTDELFSTFETWADDVLWPRLVAQYGADGKTQAHGSSA
GHEAASNAAVEVTVSNSRTQALRQDVGQAMVVETRLLTAESEKERRKKHLEIRLPDGVSY
TAGDYLAVLPINPPETVRRAMRQFKLSWDAQITIAPSGPTTALPTDGPIAANDIFSTYVE
LSQPATRKDLRIMADATTDPDVQKILRTYANETYTAEILTKSISVLDILEQHPAIDLPLG
TFLLMLPSMRMRQYSISSSPLLTPTTATITISVLDAPSRSRSNGSRHLGVATSYLDSLSV
GDHLQVTVRKNPSSGFRLPSEPETTPMICIAAGSGIAPFRAFLQERAVMMEQDKDRKLAP
ALLFFGCRAPGIDDLYREQLEEWQARGVVDARWAFSRQSDDTKGCRHVDDRILADREDVV
KLWRDGARVYVCGSGALAQSVRSAMVTVLRDEMETTGDGSDNGKAEKWFDEQRNVRYVMD
VFD
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcccagagcccaaagggctgccattgatcggcaacattggcacaattgac
caggaattccccctgggttccatggtcgctttagcagaagagcatggcgagatttatcga
ctgcgatttcccggccggacggtcgtcgtcgtttctacccacgcgctggtgaacgaaacc
tgcgacgagaagcgcttcagaaagtccgtcaattcggccctggcgcacgttcgtgaaggt
gttcatgatggactattcactgccaagatgggcgaagtcaactgggagatcgcccatagg
gtcctgatgccggcctttgggccgctttccatccgaggcatgttcgatgagatgcacgac
attgccagccagctggccctgaagtgggcgcggtacgggcccgactgccccatcatggtc
acagacgactttacccgtctgacgctggacacgctggcactgtgctcgatgggctacaga
ttcaacagctactactcaccggtgttgcatccgttcatcgaagctatgggcgatttcctc
acggaggctggagagaagccgcggcggccacctttgccggccgtgttcttccgcaatcgc
gatcagaagttccaagacgacattgctgtgctccgggatacagcgcagggggttctccag
gcgcgcaaggaagggaagagtgatcgcaatgatcttctttcggccatgctgcgcggcgtg
gactcacaaactggacagaaaatgacagacgagagtatcatggataatctaatcacattc
ctgattgctggccacgagactacctctggcctcctctcattcgtgttctatcaattgctg
aaacacccagaaacttaccgcacagcgcagcaagaggtggacaacgtggttggtcaggga
gtcattgaagtatcgcacttgtctaagcttccctatatcaacagtgttctccgtgaaacc
ctccgtctcaacgcgacaattcccctgttcacggtggaggcttttgaggatacgctcctt
gcgggcaagtaccccgtcaaggcgggtgagactattgtcaatctcctagccaagtcgcat
ctggacccggaggtatacggagaggacgcactggagttcaagccggagcgaatgtcagac
gagttgttcaacgcgcgcctgaaacaattcccaagtgcgtggaagccatttggcaacggg
atgcgggcttgcattggacgaccttttgcctggcaggaagctctcttggtcatggccatg
cttctccaaaactttgacttctcactagctgatcctaattatgacctcaagttcaaacag
acattgaccattaaaccaaaagacatgtttatgaaagcacgcttgcgtcacggcctgacc
ccaacgacgctcgagcgtcgactggcggggctggctgttgagtccgcaacacaggacaag
attgtcaccaaccctgcggataattcagtcaccggtacccggttgacgatcctctatggc
tcaaatagcggaacatgcgaaacgctagcgcggcgtattgcagccgatgccccgtctaag
ggcttccatgtcatgcggtttgacggtcttgacagtggtcgttccgcgctccctacggac
caccctgtcgtgatcgtaacctcctcatacgaaggacagcctcctgagaacgcgaaacaa
ttcgtttcttggctggaagaacttgagcagcagaatgaatcattacagctcaaaggagtc
gactttgctgtattcggctgcttcaaggaatgggcccagacgtttcaccgcatccctaag
ttggtcgacagcctgctggagaagctgggaggcagtcgcctcactgatttggggctggcg
gatgtatccactgatgagctattctcgacatttgaaacatgggccgacgatgtgctctgg
cctcgcctagtcgcgcagtatggcgcagacggaaagacgcaggcccatggctcatccgct
ggccacgaagcagcttctaatgcggctgtagaggtgaccgtctccaactcgaggacacaa
gccttgcgccaggatgtgggccaggcgatggttgtggaaacccggctgcttaccgctgag
agcgagaaggagcggcgtaagaagcacttggagattcgcttgccagatggcgtaagctac
actgcaggcgattacctcgcagtgctgcctatcaacccgcccgagaccgttcgccgagca
atgcggcagttcaagctgtcctgggatgcgcagatcaccattgcaccctcggggccaacg
actgccctgccaacagacgggcccatagcggcgaacgatatcttcagtacttatgtcgaa
ctctcccaacccgccactcgcaaagacttgaggatcatggccgatgcgacgacggacccg
gacgtacagaagatcctccgaacctacgccaacgaaacctacacagccgaaatcctcacc
aagagcatttcagtccttgacatcctcgaacaacatcccgcaattgacctcccattggga
acattcctactaatgcttccatctatgcgcatgcgccaatattccatctcctcctcaccc
ctccttacccctaccaccgccaccataacaatttccgttcttgatgccccatcacgctct
cgatccaatggatcccgtcatctcggcgtcgcaacttcataccttgattctctcagtgta
ggcgaccatctccaagtgacagtgcggaagaacccttcgtcgggattcagattgcccagc
gagccggaaaccacgccgatgatctgtatcgcggcgggatcagggatcgcccctttccgt
gcatttttgcaggagagggcggtgatgatggaacaagacaaggaccgcaaactggctccg
gcattgcttttctttggatgccgggctcccgggatagatgatctttatcgggagcagttg
gaggaatggcaggcccgcggggtcgtggatgcccgatgggcgttcagccggcaatctgat
gacacgaaagggtgtcgacacgtggacgatcgaatcctggctgatcgagaggatgtggtg
aagttgtggagagacggtgcgagggtgtatgtttgtggttcgggggcgctggctcagtcg
gttcgaagcgctatggttacggtcctgcgggacgagatggaaacgaccggcgacggttcg
gacaatggaaaggcggagaagtggttcgatgagcagaggaatgtgcgatatgtgatggat
gttttcgattag

DBGET integrated database retrieval system