KEGG   Aspergillus nidulans: AN6835.2Help
Entry
AN6835.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ani  Aspergillus nidulans
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AN6835.2
  Amino acid metabolism
   00380 Tryptophan metabolism
    AN6835.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AN6835.2
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AN6835.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 1083 aa AA seqDB search
MAEIPEPKGLPLIGNIGTIDQEFPLGSMVALAEEHGEIYRLRFPGRTVVVVSTHALVNET
CDEKRFRKSVNSALAHVREGVHDGLFTAKMGEVNWEIAHRVLMPAFGPLSIRGMFDEMHD
IASQLALKWARYGPDCPIMVTDDFTRLTLDTLALCSMGYRFNSYYSPVLHPFIEAMGDFL
TEAGEKPRRPPLPAVFFRNRDQKFQDDIAVLRDTAQGVLQARKEGKSDRNDLLSAMLRGV
DSQTGQKMTDESIMDNLITFLIAGHETTSGLLSFVFYQLLKHPETYRTAQQEVDNVVGQG
VIEVSHLSKLPYINSVLRETLRLNATIPLFTVEAFEDTLLAGKYPVKAGETIVNLLAKSH
LDPEVYGEDALEFKPERMSDELFNARLKQFPSAWKPFGNGMRACIGRPFAWQEALLVMAM
LLQNFDFSLADPNYDLKFKQTLTIKPKDMFMKARLRHGLTPTTLERRLAGLAVESATQDK
IVTNPADNSVTGTRLTILYGSNSGTCETLARRIAADAPSKGFHVMRFDGLDSGRSALPTD
HPVVIVTSSYEGQPPENAKQFVSWLEELEQQNESLQLKGVDFAVFGCFKEWAQTFHRIPK
LVDSLLEKLGGSRLTDLGLADVSTDELFSTFETWADDVLWPRLVAQYGADGKTQAHGSSA
GHEAASNAAVEVTVSNSRTQALRQDVGQAMVVETRLLTAESEKERRKKHLEIRLPDGVSY
TAGDYLAVLPINPPETVRRAMRQFKLSWDAQITIAPSGPTTALPTDGPIAANDIFSTYVE
LSQPATRKDLRIMADATTDPDVQKILRTYANETYTAEILTKSISVLDILEQHPAIDLPLG
TFLLMLPSMRMRQYSISSSPLLTPTTATITISVLDAPSRSRSNGSRHLGVATSYLDSLSV
GDHLQVTVRKNPSSGFRLPSEPETTPMICIAAGSGIAPFRAFLQERAVMMEQDKDRKLAP
ALLFFGCRAPGIDDLYREQLEEWQARGVVDARWAFSRQSDDTKGCRHVDDRILADREDVV
KLWRDGARVYVCGSGALAQSVRSAMVTVLRDEMETTGDGSDNGKAEKWFDEQRNVRYVMD
VFD
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcccagagcccaaagggctgccattgatcggcaacattggcacaattgac
caggaattccccctgggttccatggtcgctttagcagaagagcatggcgagatttatcga
ctgcgatttcccggccggacggtcgtcgtcgtttctacccacgcgctggtgaacgaaacc
tgcgacgagaagcgcttcagaaagtccgtcaattcggccctggcgcacgttcgtgaaggt
gttcatgatggactattcactgccaagatgggcgaagtcaactgggagatcgcccatagg
gtcctgatgccggcctttgggccgctttccatccgaggcatgttcgatgagatgcacgac
attgccagccagctggccctgaagtgggcgcggtacgggcccgactgccccatcatggtc
acagacgactttacccgtctgacgctggacacgctggcactgtgctcgatgggctacaga
ttcaacagctactactcaccggtgttgcatccgttcatcgaagctatgggcgatttcctc
acggaggctggagagaagccgcggcggccacctttgccggccgtgttcttccgcaatcgc
gatcagaagttccaagacgacattgctgtgctccgggatacagcgcagggggttctccag
gcgcgcaaggaagggaagagtgatcgcaatgatcttctttcggccatgctgcgcggcgtg
gactcacaaactggacagaaaatgacagacgagagtatcatggataatctaatcacattc
ctgattgctggccacgagactacctctggcctcctctcattcgtgttctatcaattgctg
aaacacccagaaacttaccgcacagcgcagcaagaggtggacaacgtggttggtcaggga
gtcattgaagtatcgcacttgtctaagcttccctatatcaacagtgttctccgtgaaacc
ctccgtctcaacgcgacaattcccctgttcacggtggaggcttttgaggatacgctcctt
gcgggcaagtaccccgtcaaggcgggtgagactattgtcaatctcctagccaagtcgcat
ctggacccggaggtatacggagaggacgcactggagttcaagccggagcgaatgtcagac
gagttgttcaacgcgcgcctgaaacaattcccaagtgcgtggaagccatttggcaacggg
atgcgggcttgcattggacgaccttttgcctggcaggaagctctcttggtcatggccatg
cttctccaaaactttgacttctcactagctgatcctaattatgacctcaagttcaaacag
acattgaccattaaaccaaaagacatgtttatgaaagcacgcttgcgtcacggcctgacc
ccaacgacgctcgagcgtcgactggcggggctggctgttgagtccgcaacacaggacaag
attgtcaccaaccctgcggataattcagtcaccggtacccggttgacgatcctctatggc
tcaaatagcggaacatgcgaaacgctagcgcggcgtattgcagccgatgccccgtctaag
ggcttccatgtcatgcggtttgacggtcttgacagtggtcgttccgcgctccctacggac
caccctgtcgtgatcgtaacctcctcatacgaaggacagcctcctgagaacgcgaaacaa
ttcgtttcttggctggaagaacttgagcagcagaatgaatcattacagctcaaaggagtc
gactttgctgtattcggctgcttcaaggaatgggcccagacgtttcaccgcatccctaag
ttggtcgacagcctgctggagaagctgggaggcagtcgcctcactgatttggggctggcg
gatgtatccactgatgagctattctcgacatttgaaacatgggccgacgatgtgctctgg
cctcgcctagtcgcgcagtatggcgcagacggaaagacgcaggcccatggctcatccgct
ggccacgaagcagcttctaatgcggctgtagaggtgaccgtctccaactcgaggacacaa
gccttgcgccaggatgtgggccaggcgatggttgtggaaacccggctgcttaccgctgag
agcgagaaggagcggcgtaagaagcacttggagattcgcttgccagatggcgtaagctac
actgcaggcgattacctcgcagtgctgcctatcaacccgcccgagaccgttcgccgagca
atgcggcagttcaagctgtcctgggatgcgcagatcaccattgcaccctcggggccaacg
actgccctgccaacagacgggcccatagcggcgaacgatatcttcagtacttatgtcgaa
ctctcccaacccgccactcgcaaagacttgaggatcatggccgatgcgacgacggacccg
gacgtacagaagatcctccgaacctacgccaacgaaacctacacagccgaaatcctcacc
aagagcatttcagtccttgacatcctcgaacaacatcccgcaattgacctcccattggga
acattcctactaatgcttccatctatgcgcatgcgccaatattccatctcctcctcaccc
ctccttacccctaccaccgccaccataacaatttccgttcttgatgccccatcacgctct
cgatccaatggatcccgtcatctcggcgtcgcaacttcataccttgattctctcagtgta
ggcgaccatctccaagtgacagtgcggaagaacccttcgtcgggattcagattgcccagc
gagccggaaaccacgccgatgatctgtatcgcggcgggatcagggatcgcccctttccgt
gcatttttgcaggagagggcggtgatgatggaacaagacaaggaccgcaaactggctccg
gcattgcttttctttggatgccgggctcccgggatagatgatctttatcgggagcagttg
gaggaatggcaggcccgcggggtcgtggatgcccgatgggcgttcagccggcaatctgat
gacacgaaagggtgtcgacacgtggacgatcgaatcctggctgatcgagaggatgtggtg
aagttgtggagagacggtgcgagggtgtatgtttgtggttcgggggcgctggctcagtcg
gttcgaagcgctatggttacggtcctgcgggacgagatggaaacgaccggcgacggttcg
gacaatggaaaggcggagaagtggttcgatgagcagaggaatgtgcgatatgtgatggat
gttttcgattag

DBGET integrated database retrieval system