KEGG   Aspergillus nidulans: AN7015.2Help
Entry
AN7015.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ani  Aspergillus nidulans
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ani03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ani03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 482 aa AA seqDB search
MAAASRPFDYLESLPGTVFFKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAADL
ETWVRSESLRLSFLRERDSALSILGRLHILTNTTTSGNVRAYMVTDPFAASLRQALTGAK
ETQSFGVLHHIPDDQTVPIHDLDEYARRQWEGVLGYMVGTSGLGIQRDVNLSKGVKQLLQ
AGHLVEIRDRRVEITQDGFAFVLQDVGTQVWHILILYVESAEAIGMDSVEVLSFIFLLSS
LELGKSYEKKHLTSNQLRTLTDLADFGIVYQDSPEASHFYPTRLATTLTSDSSALSNPIS
GALSDPDGGDSNQPGSGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLVTGKVTR
QSIRRAIEMGITADQIISYLATHAHPQMRKHNVARSTSNQAGMPPSVLPPTVVDQIRLWQ
LERDRVKATAGFLFKDFVSLAEYEAPCRYAEEIGVLIWKSDRKRMFFVTRHEQVAAFLRS
RK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcatctcgtccgttcgattacctcgaaagcctccccggaactgtctttttc
aagctataccagcagccgtccaccgctctcgctatcttcaggcgcatgctgcctgacctg
gcaaaatgcttcgttatggcgcttctctatttgaaggacccgcttccagcagcggacctg
gaaacttgggtcagatctgagagcctgaggttatctttccttagagagcgggatagtgcg
ctatcaatactgggaaggctacatattctcacaaatacgaccacctctggtaacgtccgc
gcttacatggtcaccgatcctttcgctgcatccctccgacaagcactcacgggtgcgaaa
gaaacccagtcctttggtgtgcttcaccacataccggacgaccagactgttcccattcac
gatcttgatgagtacgcgcgccgacagtgggagggtgttctcggctacatggttggaacc
agtgggctagggattcaacgcgatgtgaatttgagcaaaggcgtgaagcagcttctgcaa
gccggacatctggtggagatcagggatcgccgtgttgagataactcaagatgggttcgca
ttcgtcctccaggatgtgggcacgcaggtctggcatatcttgattctttacgtcgaaagt
gctgaggccatcgggatggatagcgtcgaagtgctgtctttcatattcctcctcagtagc
ttggaactgggcaaatcctacgaaaagaagcacttgacatcgaatcagctccgcactcta
accgatttagcagactttggtattgtctatcaggattctcctgaggcgagccatttctac
cctactcgtcttgcaaccactcttacgtccgactcaagcgccctcagcaaccccatctct
ggcgcactctccgatccggacggcggggattccaaccaaccgggttctggattcattatc
attgaaacgaattatcgactttacgcttacacttcttcgccgcttcagatttcgcttatt
gcgctcttcacgacactcaagtaccgcttccctaacctggtcacgggaaaagtgacccgg
cagtctatccgccgggcgattgaaatgggcatcacagccgatcaaattatctcttacctt
gctacccacgcacacccgcagatgcgcaaacacaatgtcgctcgctcgacatccaaccag
gctggaatgccaccgtcagtccttccaccaacagttgttgaccagatccgtctttggcag
ctggagcgtgaccgtgtcaaagctacggctggctttctgttcaaggattttgtcagcctt
gccgagtacgaggctccgtgtcggtatgccgaagaaattggcgttctgatttggaagtca
gatcgcaaaagaatgttctttgtgacacgacatgagcaggtcgcggctttcttacgaagc
aggaaataa

DBGET integrated database retrieval system