KEGG   Aspergillus nidulans: AN7019.2Help
Entry
AN7019.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AN7019.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 1125 aa AA seqDB search
MDSSKTSAAPNETLSRTPPRPPPPIDPFVVSDRLSDPSLTATPLPASPSAVSSSSLLSPS
DLPARSGVNPVPHPAPRRVPSASSLRDERRQSTPNLKKRSSTASLRSSQLGGSTSPRPSM
SRRSSSALATSPTAASANAGGPAAPSKASLAVEQPVLTAASIAAEHFKKEFNHHQSADLQ
SETLVIIHDACYGHRFSRPRTTRAALSSIVERPERVQACVVGISAAYVRLARRHAGGLFA
PHPDLDLRELPVPPFQIRKTDRALAINSPAVTHVHGTKWMEDLKLMCDAAESRLALNGKE
LVRPRSAGKDNSSGNPGPVFHEGDLYLCSESLDAFEGALGGVCEGIDAVFSPGPTKRAFV
CIRPPGHHCSSGNPSGFCWINNVHVGISYAAMTHDLTHAAILDFDLHHGDGSQDIAWEQN
KKALAAPKNAAAHKKAMVGYFSLHDINSYPCEMGEAEKIRNASVCIEKAHGQSIWNVHLE
PWKTEQDFWELYSAKYSILIEKARDFLKMHTDRLASVPNGPPPKAAIFISAGFDASEWEG
MGMQRHKVNVPTEFYARFTADVVRMAEEEGLGVDGRIVSVLEGGYSNRALTTGVLSHLSG
LGDTKGVQLLDDRHIDRLATEMTERLGLSDTPPERPAFQAAYDQEWWSLPLLEELEALVY
PPPPSKPKEKSAPTYFAPTQSFAAKVVLPARDRRSTGSHSSEQESPPLPPVNWAVAAHEL
SKVLIPSDRRTGSCRPEELNAEASRLRRERHATATGISDAVKTPTGPAAGEEKMKLRIRK
PKTSSPIVSEPATPARRTNKDNRRTTLDPPSVARDSSKSPGPRISRRKSAAPTTSKTSSA
TEEDQPPPRPLSQGSVTIRKTSVSRSAAPRRSASPKGAPPLPRMPTKFLPATTQDEQSRA
SQHTSGASERASDDMDSLTSGVRKLSIKLKVPSPEENAARERKAAEERKRKILKGSSKAP
RSPKKAPAAKQPLTDTSKKISQPSPNNSHMDSPLPDVPRQMSTDTEASSAENQISQPLAT
TDASSPTPTIEAKESLPIEDHHRGKEQAIGGLSHSSSQGTYAVISPPLTPGHAGDPAGPM
STLFSPPASASVTRDGLPGFTSNGRIPFAPTDDSQRSTMTITRSE
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atggattcctccaagacgtctgcagctcccaatgaaaccctctcaagaacgccccctcgc
cctccccctcccatcgatcccttcgtcgtctctgaccgtctgagtgatccgtcccttaca
gcgactcctttaccagcctctccgtctgcggtttcctcttcgtcgctcctatcgccgtcc
gatcttcccgcacgttcgggcgtcaacccggtgccgcatccagcaccaaggcgcgttccc
agtgcaagctcgctaagagatgaacggcgtcaatcaacacctaatctgaagaagcgctct
tctactgcctctctccgttctagccaactcggaggttctacctctccccgacccagcatg
tcgcgtcgctcgtcctctgctcttgcgacgtcacctacggccgcctctgcgaacgctggc
ggtccggccgcgcccagtaaggcttcgctcgctgtagagcagcctgtgttaacggctgct
tccatcgccgctgagcacttcaaaaaggagttcaaccaccatcagtctgccgatctacaa
tccgagactttggtgatcattcatgatgcgtgttatggccatcgcttttcgcgtccccgc
actactcgcgccgcgttgagctcgattgttgagcggccggagcgcgttcaggcctgtgtt
gtaggcatctccgctgcgtatgttcggcttgcccgcagacatgctggtgggctgtttgct
ccccacccagatttggatctgcgcgagctccctgttccgccgttccagatccgcaagaca
gatcgggctttggcgataaactccccagcggtcacccatgtgcacggaacgaaatggatg
gaagacctcaaattaatgtgcgacgctgctgaatcgcgcctcgcgcttaatggcaaggaa
ttagtacggcctcgtagtgctgggaaagataactctagcgggaaccctgggccggtattt
catgaaggagatctatatttatgctccgaatcgttggacgcattcgaaggagcgttgggt
ggagtgtgcgaaggcatagacgctgtgtttagccccggaccgacgaaacgcgcattcgtt
tgtattcggcctccggggcatcattgttcttctggcaacccatccggattttgctggatc
aacaatgttcatgtaggaatctcctacgctgcgatgacccatgatctcacccacgctgcg
atcctggactttgatctccatcacggtgatggctcgcaggatatcgcttgggaacagaac
aagaaggcgttagctgctccgaagaatgctgccgcccacaaaaaagctatggttgggtat
tttagcttgcacgatatcaattcgtacccgtgtgagatgggcgaagcggagaagatccgc
aacgcgagtgtatgcattgagaaagcacatgggcaatctatctggaacgtacatctggaa
ccgtggaagacagagcaggacttttgggagctctattctgcgaaatactcaatcctgata
gagaaggctcgtgactttctgaagatgcacactgaccgtctggcaagtgttcccaatggc
cctccacccaaggcggcaatattcatttcggccggcttcgatgctagcgaatgggaaggc
atgggcatgcaaaggcacaaggtcaatgttcctaccgaattttacgccagattcacagcc
gatgttgtgcggatggcagaggaggaaggtcttggtgttgatgggcgaatcgtaagcgtc
cttgaaggagggtacagtaatagggctcttacgactggtgttttgagtcacttgtcaggg
ctaggggataccaagggtgtgcaattgctcgatgatcgtcacatcgaccgtttggcgact
gagatgacagaacgcctcggcttgtccgacacccctcctgaaaggccagcttttcaggcc
gcttatgatcaggaatggtggtctctgcctctgttggaggagctggaggccttagtatac
ccgcctcctcccagcaagcctaaagagaaatcagccccgacctacttcgccccaacccaa
tcgtttgctgcaaaggttgtcttaccggcaagggatcggcgctccaccggctcccatagc
tcagagcaggagtcaccacctctaccaccagtcaattgggccgtggccgcacacgagctg
tccaaggttctaataccaagcgaccggcgaaccggcagctgccggcctgaagaactcaat
gctgaggcttcacgcttgagacgtgaacgccacgcaacagcaaccggcatcagcgatgca
gtgaagacgccgacgggaccagctgcaggagaggagaagatgaaactccgtataaggaaa
cccaagacttcctctcccattgtttcagagcctgcgactcccgcccgtcggactaacaag
gacaatcgcagaacaacattagatcctccaagcgttgcccgcgactcatccaagtcccct
gggccgcgcatttcacgaagaaagagtgcagctccgacaacttccaaaacatcttcggct
actgaggaagaccaaccccctccgcggccattgtcgcagggctcagtgacgatacgcaaa
actagtgtgtcgcgatctgcagctcccaggcgctctgcgagtcccaagggagcgccacct
ttaccccgtatgccgaccaagttcctacctgcaactactcaagatgagcagtcgagggca
tcgcagcatacgtctggcgccagcgagagggcgagtgacgacatggatagtctcacgtcc
ggcgtacgaaagctgagcataaagctgaaagtgccttctccggaagagaatgcagcccgg
gagaggaaggcagcagaggagcgcaagcgtaagatccttaaagggtcatctaaggctcct
cggtctcccaagaaagcgccagcggctaagcaacctctaaccgatacttccaaaaagata
tcccagccttctccgaacaactcccacatggactcgccgcttccagatgtccctagacaa
atgtccactgacactgaggcgtcgtctgctgaaaatcaaataagccaacctttggcgaca
acggatgcttcttcgcccacgcctaccatcgaggctaaagaatcgcttccaattgaagac
caccatcgaggcaaagagcaagccattggcggacttagtcattcgtcatctcagggtaca
tacgctgtgatttcaccacctctcacccctggccatgctggcgatcctgcaggtcccatg
tccactctattttcgcctcctgcgtcagcgtcggtaaccagagatggccttcctggattc
acatccaatggacgaataccgtttgctccgactgatgactcacaaagatcaaccatgact
attacccggtcagaatag

DBGET integrated database retrieval system