KEGG   Aspergillus nidulans: AN7104.2Help
Entry
AN7104.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AN7104.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AN7104.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 871 aa AA seqDB search
MNSQWQPYKDPLVGRPAQFNNNGLTSNPNTQQLPSNYGGQSQSSQAPAGYTYEPFQSPGI
IAKPPSTKSASMASSPAATPHTRDYVTEQDAIMEDADPYNRAKYPTRSNHQSRPSSQYFP
SEGSTAARRYSPMNVLSPTLPYNSSPGKSGNTYAFPPATHPSRQSPTRTPNYSSPPQPFQ
SPPSGSRPPRLPPLQPTDMSPDQFFGPSSGPQLSSPFAQDGWSRTGSGAPQQPGRGPLPK
FQKIKSIQDLKPRINAQPAYRRANPEGGFISPLQALTNHLPATYRICNPNFHYESSRNPR
RVLTKPSKGVKNDGYDNEDSDYILNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKN
KTAYFNQSMMEVSVLDLLNSRYDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQ
NQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENILLKNLESPIIKVIDFGSACD
ERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRI
VEMLGLPPTWMLEMGKQSGEFFEKTQDEFGRKSYRLKSLEQYSREHNTKEQPSKKYFQAS
TLEEIIRSYPMPRKNMKQAEIEREVNNRVAFIDFVRGLLSINPLERWSPQQAKLHPFITQ
QKFTGPFVPPMNLKYSSLNKTLPPGIQQQQQAEAASKQRAAHAQSAAQSAYTMQMNQYHP
SAHAQPPPPMYTGMYGGHQQPPPPYPTQPPAYGHQMNLMPGQMPQTQYGASQSLYAQATT
RAGRQRASTMDPQGVPPTIQRVASHLDPNAPIRLQPSPAYYPPPADGYADPNSANQRRRG
SRVGGTRNRDFIRTLEDGVLGDGYMGQNQWH
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcagtggcagccgtataaagatcccttggtgggtcgtcctgcgcaattcaac
aataacgggttgacgtcgaatccgaacactcaacagctgccttcgaactacggcggccag
tcacaatcatctcaggctcctgctggctacacttacgagccttttcaatccccgggcatc
attgccaaaccgccttcgacaaaatcggcttcgatggcgtcgtccccagctgctacaccc
catacccgggattatgtcactgaacaggatgccatcatggaagatgcagatccatataac
cgggccaaatacccaacaaggtcgaaccatcagagccgaccgtcttcgcagtactttccc
agcgaagggtctaccgctgcccgcagatactctccgatgaatgtgctgtcgccaactttg
ccctacaactcaagcccaggaaaatctggcaatacgtacgctttcccgcccgcgacgcat
ccatctaggcagtcgccaacacgaacgccgaattactcctcgcctccccagccgtttcag
tcgcctccttctggttcgcgtcctccgagattacctccattgcaacccacagacatgagc
ccggatcaattttttggtccatcgtcaggacctcagctcagctcaccgttcgcgcaggac
ggatggtcacgcacgggatccggggcccctcagcagccggggcgaggcccgttgccgaaa
ttccaaaagatcaaatcgattcaagacctcaagcctcgcatcaatgcccagcccgcgtac
cggcgtgccaatcctgagggtggcttcatcagcccacttcaagctttaacgaaccatctt
ccagctacttatcggatatgcaatccgaactttcactacgagtcgtcaaggaacccacgg
cgggttctcacaaagcccagtaagggcgtcaagaacgacgggtacgataacgaggacagc
gattacattttgaatcgctatctcattcttgacgtcctcggccaagggacctttgggcaa
gtcgttaagtgccagaatctcaagacgcaggaggtcgttgctgttaaagtaatcaagaac
aagactgcgtacttcaatcagagtatgatggaggtatcagttttggatttgctcaacagc
agatacgacaaaaacgacgaccaccatctccttcggttgaaggacacttttatacaccgt
caacatctttgtttggtatttgagctactcagcgtgaacctttacgagttgatcaagcag
aatcaattccgaggcttgagtacaactcttgtgcgcgtttttgcgcagcaattgctcaac
gcactgagccttctgaataaggcgcacttgattcattgcgatcttaagccggagaatatt
ttgctgaaaaaccttgagagccccattattaaggttattgactttgggtccgcctgtgat
gaaagacaaacagtttacacatacatccagtccagattttaccgctcaccagaggtgctt
ctcggcttgccatactcttccgcaatcgacatgtggtctctcggttgtatagtagtcgag
ctgtttctgggcttgccgctattccctggatcctcagaatacaaccaggtgtgtcgcatt
gtggagatgctaggtttaccgcctacctggatgttggaaatgggaaagcagtctggtgaa
ttctttgagaagactcaggacgagttcggacgaaagagttaccggctgaagagcctggag
cagtattcccgggaacataacacaaaggagcaacccagcaagaaatatttccaagcatcg
acactggaggaaatcattcggagttatccaatgccaaggaaaaatatgaaacaggcagag
attgagagagaagtcaacaaccgcgttgcattcattgacttcgtccgtggtctgctgtcg
atcaatccgctcgagcgctggtcgccgcaacaagcaaagctccacccgttcattacacag
caaaagttcaccgggccgtttgtccccccaatgaacttgaagtattcgtctcttaacaag
accctcccacccggtattcagcagcagcagcaagcggaagctgcgagtaagcaaagggcg
gcacatgctcaatccgccgctcagagcgcgtacacaatgcaaatgaaccagtaccatcct
tcggcacatgcgcagccgccaccaccgatgtacacggggatgtatggcggacaccaacaa
ccgcctccaccataccccacacagccgccagcatacggccaccaaatgaatcttatgccc
ggccaaatgccccaaacgcaatacggggcctcccagagcctttatgcacaagcgacaacg
agggctggccgtcaacgtgcgtcaaccatggatcctcagggggttccaccaactatccaa
agagttgccagccatttggatcccaatgcgcctattcggctgcaaccaagcccggcttac
taccctccgccggccgatggttatgctgaccctaactctgcaaatcaaagacggcgaggc
agccgtgttggtggaacacgaaaccgggatttcatccgcactcttgaggacggcgtcttg
ggggatggctacatgggtcaaaaccagtggcactag

DBGET integrated database retrieval system