KEGG   Aspergillus nidulans: AN7402.2Help
Entry
AN7402.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ani  Aspergillus nidulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ani00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 661 aa AA seqDB search
MPTTILKITLFPLIDSIFSVQLSPVRIAMLTLSKVLPVLALSHAVAAAPQLSARATASLN
TWLSTEASFALDGILTNIGANGAYAKTAKAGADYYTWTRDAALTVKVLVDLFHNGDLSLQ
TILEEYTNSQAYLQTVSNPSGGLASGGLAEPKFYVDMTAFTGSWGRPQRDGPALRATTLI
GFGNWLIDNGYSSYASNNIWPIVRNDLTYVAQYWSKSGYDLWEEVNSMSFFTVAVQHRAL
VEGSTFAHRVGASCPWCDSQAPQILCYMQNFWTGSYINANTGGGRSGKDANTVLASIHTF
DPDAACDDITFQPCSSRALANHKVYTDSFRSVYSLNTGIAQGVAVAAGRYPEDSYYNGNP
WFLTTLAAAEQLYDAIYQWQKARSISITSTSLAFFKDIYSSAAVGTYASGSSAFTAIIDA
VKTYADGYVSIVKAHAMANGSLSEQFDKTYGTCVSARDLTWSYAALLTASMRRNGVVPPS
WDAASANTLPSSCSTGSATGTYSTATVTTWPSTLTSGSASATTTIMATSTATSSSTTTST
TTACTTPSTVAVTFNVIATTTYGENVYIVGSISQLGNWDTGSAVALSASKNTSSNNLWYV
DINLPGGTAFEYKYIRKETDGSIVWESDPNRSYTVPSSCGVSTATESDTWRCTLETQSVR
N
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgactattttaaaaataaccttgttccccctgattgactctatcttttctgtc
caactctcgcctgttcgcattgccatgcttaccctctctaaagtacttcctgtgctagct
ctcagccatgctgtcgcggcggctcctcagttgtctgcgcgggctactgccagcttaaat
acctggttatctaccgaggctagctttgctctggatggcattctcaccaatattggcgca
aatggcgcttatgcaaagaccgccaaggctggagcagactactatacctggacacgagat
gccgctctgaccgtgaaagtccttgtcgacctgtttcacaacggcgatctgagcctacag
actattcttgaagaatataccaactctcaggcatatttgcagaccgtctcaaacccatct
ggtggtctggcgagtggagggcttgcagagcccaagttctatgttgatatgaccgccttt
accggctcctggggtcgtcctcagcgagatggcccggccctgcgcgctactacccttata
ggtttcggcaactggttgattgataacggctactccagctatgctagtaacaatatctgg
cctattgtgcgcaacgacttgacctacgttgctcagtattggagcaagagcggctatgat
ctatgggaagaggtgaactctatgtccttcttcaccgtcgccgtgcagcatcgtgcgctc
gttgaggggagcacttttgcccacagagtaggagcctcctgtccatggtgtgattcacag
gcccctcagatcctctgctacatgcagaatttctggacaggctcatatattaatgccaat
accggtggtggccgatctggcaaggacgccaacaccgtcctggccagcattcacaccttc
gaccccgacgctgcttgcgatgatatcactttccaaccctgctcctctcgtgccctcgcc
aaccacaaggtatacactgactcgttccgctccgtgtactcgctcaatacaggcatcgca
cagggcgttgctgttgcagccggtcgctatcctgaagattcatactacaatggtaacccc
tggtttttgacaaccctcgccgcagccgagcagctctacgatgccatctaccagtggcag
aaggctaggtccatctcgatcacgagcacctctctcgctttttttaaggacatctacagc
tcggccgccgtaggcacttacgcctcggggagctccgcgttcacggccatcatcgacgca
gtcaagacgtacgccgatggctacgtgagcatcgtcaaggcccacgccatggctaacggc
tccctttctgaacaattcgacaagacatacggcacctgcgtatccgcgcgcgatctgacc
tggtcgtacgctgctctcctgacggccagcatgcgccgtaacggcgtcgtccctccctca
tgggacgccgcctctgcaaacaccctcccctcatcttgttccacgggctctgcaactgga
acttacagtaccgcgaccgtcacaacctggcctagcaccctgaccagcgggtcggctagc
gcgaccacgaccatcatggctacgtcgactgccaccagcagcagcactaccaccagcacc
accaccgcctgtacaacaccaagcaccgttgccgtgactttcaatgtgatcgccacaact
acctacggtgaaaatgtgtacatagtaggctccatctcccagctgggaaactgggatacc
ggcagtgccgttgccctcagcgcctctaagaacacctcctccaacaacctctggtatgtg
gacatcaatctcccgggcgggacggcgtttgagtacaagtacatccgcaaggagacggac
ggctcgatcgtttgggaaagtgaccctaatcgctcgtacactgtgccttcaagctgtgga
gtgtcaacggctactgagagtgacacttggcgttgtacactagagacgcagagtgtacga
aattga

DBGET integrated database retrieval system