KEGG   Aspergillus nidulans: AN7422.2Help
Entry
AN7422.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AN7422.2
Peptidases [BR:ani01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AN7422.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AN7422.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 697 aa AA seqDB search
MIYLNYGHRLPLKPFIEKTREEPPHKISKLAINAETDEDRYDTSTRVVCYSCGRDDVGEP
SGKLQSVIEGVMHATTFSKREEIKAWEQEFIPCEHTTGLIQQESKRIKSQGCGRSQFGGT
GGNSHGLAHFNATSHAVAVKLGSITADGSADIYCYKCNEERIDPDLATHLYHWGIDLAGR
EKTEKSLMEMQVEQNLKWDFLMTTEDGQDLTPVFGAGLTGLSNLGNSCYLSSVVQCLFDL
PEFQRRYYHPNEDPPLAETPAADFETQLRKLADGTLSGRYSRPDDKTVASPKPQEIRHQK
GLAPSMFKHLIGRDHPEFSTMRQQDAFEFLLHVFKHVTLSKHPVGMDNPIDSFKFSIEQR
LQCLKCRGVRYRLDEQDNISIPVPARRVPDSEGSNSDGSFESVTLYDCLDAFTADETVDL
RCAHCNSQEKFSKRSAFRTMPAELVINARRFELINWVPTKLDIPVEVEDAPIDLSCYLST
GPGEGEDLLPEDEETGGFEVNMDTLNQLLAMGFPRVRCEKALYSTGNSDAEAAMNWLLSH
MDDPDIDEPVHKKRVSEFGANEQDLAKIAQLGDMGIDDSRARKALTATGGDINRAIDWVF
SHPGDEDESSVHEPPSGNADTSVVPGFATSPATYQLRSIICHKGASVHAGHYVAFVRKHL
PGKSGLSWVMFNDEKVVEVDDVQEMKKFAYLYFFSRV
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgatttacctgaactacggccaccgtctgcctctcaagccgtttatcgagaagactcgc
gaggagcctccacataagatctcaaagcttgccatcaacgcagagactgacgaagaccgt
tatgacacaagtacacgtgttgtctgctattcctgcggcagggacgatgttggtgagccg
agtggcaaactccagtcagtcattgaaggcgtgatgcatgccacgaccttctcgaagaga
gaggagataaaagcctgggaacaggagtttattccctgcgagcacactactggcttgatt
cagcaggagtccaagcgcataaagtcacagggctgtggtcgcagtcaatttggaggtact
ggcggtaattcacatggacttgcacactttaatgcgacatcccacgccgttgccgtgaaa
ctgggttcaataactgccgatggttcagcagatatttactgttataaatgcaacgaagaa
agaatcgatcctgaccttgctacgcacctgtatcattggggcattgatttagcggggcgc
gagaaaacggagaaaagtctcatggaaatgcaagttgaacaaaatctgaaatgggatttc
ttgatgacgactgaagatggacaggatctgacaccagtcttcggcgcaggcctgacaggg
ttgtcgaatcttggaaacagttgctatctgtctagtgtggtccagtgcctttttgattta
ccagagtttcaacgcagatattaccatcctaacgaagacccgcctctggcagaaacacca
gctgctgatttcgaaacgcagctgcgaaaactggcggatggtaccctctcaggacgatac
tctcggccagatgataagactgtcgcctctccaaagccacaagaaatccgacaccaaaag
ggcttggctccatcgatgttcaagcatcttatcggtcgcgatcatcctgaattctcgact
atgagacagcaggacgcctttgagttcctactgcatgttttcaagcacgtcacattgtcc
aagcaccctgtagggatggataatccgattgattctttcaagttcagcattgagcagcgg
ctgcaatgtctgaagtgcagaggagttcgctacaggctcgatgaacaagacaatatctcg
attccagtgcccgctcgtcgagtacccgattcagaaggttccaactctgatggctccttc
gaatctgtgacgctatacgattgtctagacgcatttactgccgatgagaccgttgatctt
cgttgtgcccattgtaacagccaggagaaattctccaaacggtctgcttttcggacaatg
ccagcggaattggtaattaatgctcgacgctttgagctgatcaattgggttccgaccaag
ctggatattccggtagaggttgaagatgcacctatagatttgagctgctatctttccacc
ggacctggtgagggggaagacctccttccggaagatgaggagaccggtggcttcgaggtc
aacatggacactttgaaccaactgcttgcaatgggttttccacgggtcaggtgtgaaaag
gcactttactctactggaaactcagatgctgaagccgcaatgaattggctcttatctcac
atggacgaccctgacatagatgagccggttcataaaaaacgcgtttcggaatttggagcc
aacgaacaggacttagctaaaatagcgcaactaggtgacatgggcatcgatgattctcgc
gctaggaaggcgttgactgccacaggtggtgatattaaccgagctattgactgggttttc
agtcatccaggcgatgaagatgaaagctctgttcacgaaccgccgagcggaaatgctgat
acatccgtagtcccgggtttcgctactagtccggcaacctatcaacttcgctccataatt
tgccataagggcgcttcggtacatgctgggcattatgttgcatttgtgcgaaaacatttg
cccggaaagtccggtctttcttgggtgatgttcaatgatgagaaggttgtggaggtcgac
gacgtgcaagaaatgaaaaagttcgcctacctctacttcttctcaagagtgtag

DBGET integrated database retrieval system