KEGG   Aspergillus nidulans: AN7436.2Help
Entry
AN7436.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ani  Aspergillus nidulans
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ani04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 513 aa AA seqDB search
MRSFGPWALSLLGAAAAVSAADSQSETPSDVISLTKETFNDFLVEHDLVLAEFFAPWCGH
CKALAPQYEEAATELKAKNIALVKVDCTAEEDVCREQEVTGYPTLKVFRGPDNVKPYQGA
RKTEAIVSYMVKQSLPAVSTVTEETLEDFKTMDKIVIVGYFAEDDKESSEAYTAFAESQR
DNYLFASTNDAAVASAENVKQPSIVLYKDFDEKKAIYDGSLDSEALLSWVKTASTPLVGE
VGPETYSGYIAAGIPLAYIFAETQEERAKFAEEFKPIAEKHRGAINIATIDAKAFGAHAG
NLNLDPKTFPAFAIQDPAKNAKYPYDQTKELSAKDVSKFIQDVLEGKVEPSIKSEPVPET
QEGPVTVVVAHSYKDLVIENDKDVLLEFYAPWCGHCKALAPKYDELAELYAKSKDFASKV
TIAKIDATANDVPDSITGFPTIKLFPAGAKDAPVEYSGSRTVEDLANFVKENGKYGVDAF
AAQAEEAEEVAEDATETASDAEPSAEKPEHDEL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcctttggtccgtgggcgctgagccttctaggagctgctgcggcggtttctgct
gcggattctcagtccgaaacaccatccgacgtcatttcgttgaccaaggagaccttcaat
gacttcctggtggagcatgatctagttcttgcagagtttttcgcgccctggtgtggtcac
tgcaaagctctagcgcctcaatacgaagaagcggctaccgaattgaaggccaaaaacatc
gccttggttaaggttgactgcactgcggaggaagatgtttgtagggagcaagaagtgaca
ggttaccctacccttaaggtcttccgcggccctgataatgtgaaaccctaccaaggagcg
cgaaaaacagaagcgattgtctcgtacatggtgaaacaatcgcttcctgcggtttctact
gtgactgaagaaacccttgaggacttcaagaccatggataagatcgttattgtcggctac
tttgctgaggatgataaggaatcgtctgaagcttacacggcctttgctgagagccagagg
gataactatctgtttgcttccaccaatgacgctgcggttgctagcgctgaaaatgtgaag
cagccttccattgtgctctacaaagactttgatgagaaaaaagctatctatgatgggtcg
ctcgactctgaagccctgctcagctgggtgaagaccgccagcactcccctcgtgggtgag
gttgggcctgagacttactctgggtacatcgcggccggcatccccctggcttacatattc
gccgaaacccaggaagagcgcgctaaattcgccgaggagttcaaacccattgcagagaag
cacaggggcgctatcaacatagccacaattgacgccaaggcttttggtgcccatgccgga
aacctcaaccttgaccccaagacgttccctgcctttgccatccaggatcccgcgaagaac
gcgaagtacccgtatgaccagaccaaggaactttcggctaaggatgtcagcaagttcatt
caagatgtcctagagggcaaggttgaacccagcatcaagtctgaacccgtgcctgaaact
caagagggccctgtcacagtcgtcgtggcccactcatacaaggatcttgtgatcgagaac
gacaaggatgtccttcttgaattctacgcaccatggtgtggacattgcaaggctcttgcc
cccaaatatgatgaattggccgagttgtatgccaagagcaaagatttcgcatctaaggtc
actattgcaaagatcgacgcgacggccaacgatgtccctgactctattaccggttttccg
accatcaaattattccctgcaggcgccaaagacgcacctgttgaatattcgggttctcgt
accgtggaggatctcgcaaatttcgttaaagagaacggcaaatacggtgtcgatgctttc
gccgctcaggccgaggaggccgaagaagttgccgaagatgccactgagaccgccagcgac
gctgagccctctgctgaaaagcctgagcatgacgagctttga

DBGET integrated database retrieval system