KEGG   Aspergillus nidulans: AN7436.2Help
Entry
AN7436.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ani  Aspergillus nidulans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AN7436.2
Enzymes [BR:ani01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AN7436.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AN7436.2
  Exosomal proteins of colorectal cancer cells
   AN7436.2
  Exosomal proteins of bladder cancer cells
   AN7436.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 513 aa AA seqDB search
MRSFGPWALSLLGAAAAVSAADSQSETPSDVISLTKETFNDFLVEHDLVLAEFFAPWCGH
CKALAPQYEEAATELKAKNIALVKVDCTAEEDVCREQEVTGYPTLKVFRGPDNVKPYQGA
RKTEAIVSYMVKQSLPAVSTVTEETLEDFKTMDKIVIVGYFAEDDKESSEAYTAFAESQR
DNYLFASTNDAAVASAENVKQPSIVLYKDFDEKKAIYDGSLDSEALLSWVKTASTPLVGE
VGPETYSGYIAAGIPLAYIFAETQEERAKFAEEFKPIAEKHRGAINIATIDAKAFGAHAG
NLNLDPKTFPAFAIQDPAKNAKYPYDQTKELSAKDVSKFIQDVLEGKVEPSIKSEPVPET
QEGPVTVVVAHSYKDLVIENDKDVLLEFYAPWCGHCKALAPKYDELAELYAKSKDFASKV
TIAKIDATANDVPDSITGFPTIKLFPAGAKDAPVEYSGSRTVEDLANFVKENGKYGVDAF
AAQAEEAEEVAEDATETASDAEPSAEKPEHDEL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcctttggtccgtgggcgctgagccttctaggagctgctgcggcggtttctgct
gcggattctcagtccgaaacaccatccgacgtcatttcgttgaccaaggagaccttcaat
gacttcctggtggagcatgatctagttcttgcagagtttttcgcgccctggtgtggtcac
tgcaaagctctagcgcctcaatacgaagaagcggctaccgaattgaaggccaaaaacatc
gccttggttaaggttgactgcactgcggaggaagatgtttgtagggagcaagaagtgaca
ggttaccctacccttaaggtcttccgcggccctgataatgtgaaaccctaccaaggagcg
cgaaaaacagaagcgattgtctcgtacatggtgaaacaatcgcttcctgcggtttctact
gtgactgaagaaacccttgaggacttcaagaccatggataagatcgttattgtcggctac
tttgctgaggatgataaggaatcgtctgaagcttacacggcctttgctgagagccagagg
gataactatctgtttgcttccaccaatgacgctgcggttgctagcgctgaaaatgtgaag
cagccttccattgtgctctacaaagactttgatgagaaaaaagctatctatgatgggtcg
ctcgactctgaagccctgctcagctgggtgaagaccgccagcactcccctcgtgggtgag
gttgggcctgagacttactctgggtacatcgcggccggcatccccctggcttacatattc
gccgaaacccaggaagagcgcgctaaattcgccgaggagttcaaacccattgcagagaag
cacaggggcgctatcaacatagccacaattgacgccaaggcttttggtgcccatgccgga
aacctcaaccttgaccccaagacgttccctgcctttgccatccaggatcccgcgaagaac
gcgaagtacccgtatgaccagaccaaggaactttcggctaaggatgtcagcaagttcatt
caagatgtcctagagggcaaggttgaacccagcatcaagtctgaacccgtgcctgaaact
caagagggccctgtcacagtcgtcgtggcccactcatacaaggatcttgtgatcgagaac
gacaaggatgtccttcttgaattctacgcaccatggtgtggacattgcaaggctcttgcc
cccaaatatgatgaattggccgagttgtatgccaagagcaaagatttcgcatctaaggtc
actattgcaaagatcgacgcgacggccaacgatgtccctgactctattaccggttttccg
accatcaaattattccctgcaggcgccaaagacgcacctgttgaatattcgggttctcgt
accgtggaggatctcgcaaatttcgttaaagagaacggcaaatacggtgtcgatgctttc
gccgctcaggccgaggaggccgaagaagttgccgaagatgccactgagaccgccagcgac
gctgagccctctgctgaaaagcctgagcatgacgagctttga

DBGET integrated database retrieval system