KEGG   Aspergillus nidulans: AN7488.2Help
Entry
AN7488.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ani  Aspergillus nidulans
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ani00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 430 aa AA seqDB search
MKLTWAGLWALAGTALCCSHHDEESVPQEVREELLKKWNQEWSFSGHASFAHLKPVKCLV
EPDEKYDIAIIGAPFDTAVSYRPAGARFGPRAIRAASARQMAGTSYNTRAGINPYSSWAT
IKDCGDIPITPFDNGLAERQMYEAFLELGTRSPVTPASSEYGSKGISAGKSKLVTLGGDH
SVALPALRALYQIYQKPITVLHFDAHLDTWNPVRYSAYWQSEQSAFNHGSFFHKASREGL
ICNSTSAHAGLRTRLTGIDDSDYTAPGTPEQGFMRIHADDIDELGGPMGVVNKIMERIGL
DLDQPVYLSVDIDVLDPSTAPGTGTPEPGGWTTREFIRILRGIEKLNIVGADIVEVSPSY
DNKGETTALAAAQVAYEIITSMVKNGAGKDLGGWYGRKESVTQESVPVVDAEAEVEAEVP
EPESVLKDEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgacctgggctggattgtgggcgttggctggaacggcgctgtgctgctctcat
catgacgaagagtctgttcctcaagaggtgcgagaggagctactgaagaaatggaatcaa
gagtggtctttctccggacatgccagctttgcgcacttgaagcccgtcaaatgtctggtc
gagccggatgagaagtacgacattgccatcatcggtgcgcctttcgacaccgcggtcagc
taccgcccagcaggagctcgctttggtccgcgcgcaatccgcgccgccagcgcccgccaa
atggctgggacatcctacaacacccgcgcagggataaacccatacagctcatgggcgacg
atcaaagactgcggcgacatccccattaccccattcgacaacgggctcgctgagcgccaa
atgtacgaggcctttctggaactcggcacccgcagccccgtcacgcccgcctcatctgag
tatggcagcaagggcatctccgcgggcaagagcaagctcgtcacgctgggaggcgaccat
agcgttgcgctccctgcccttcgagcgttgtatcagatttatcagaagcctattactgtc
ctgcacttcgacgcgcacctggacacctggaacccagtgcgatactcggcgtactggcag
tcggagcagtcggcattcaaccatggcagctttttccacaaggcgagtcgtgaggggcta
atttgcaactcgacctctgcacatgcgggtctgcggacaagacttaccggtatcgatgac
agcgattacacggcccccggaacgccggagcaagggttcatgcgtattcacgctgacgat
atcgatgagcttggtggacccatgggtgtcgtcaacaaaattatggagcgtattggcctc
gatttggaccagcctgtttatctctctgtggacattgacgtacttgacccttctactgcg
ccaggcactgggacacccgagcccggtggctggacaacccgtgagttcatccgcattctg
cgggggattgagaagttgaacatagttggcgcggatatcgtcgaagtatctccaagctat
gataacaagggtgagacgactgccctcgccgctgcgcaggtggcgtatgagatcatcact
agcatggtcaagaacggtgcgggtaaggacttgggtgggtggtatggacgtaaggaaagc
gttacccaggagtctgttccagtggttgatgctgaagctgaagttgaagccgaagtgccg
gagcctgagtccgtgctcaaggacgaactttaa

DBGET integrated database retrieval system