KEGG   Aspergillus nidulans: AN7491.2Help
Entry
AN7491.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AN7491.2
Peptidases [BR:ani01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AN7491.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 249 aa AA seqDB search
MSDPDVPESNKAFVPLENNPEVMSHLVHQLGLSPSLGFTDVFSIDEPDLLALVPRPSQAL
LLVFPVSKSYESSRIAEDSSLPEYTGSGPNEPVMWFKQTIRNACGLIGLLHAVSNGEARK
HILPGSDLENLLKEAEKLDPIRRADLLYESKALESAHADAAKLGDTKAPGAEDDVDLHFV
AFVKGEDGRLWELDGRRRGPLERGVLGDEEDALSERALELGVRRFLDVEAKGGNPDLRFS
LVSLGAVFD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacccggacgttcccgaaagcaacaaagctttcgttcctctcgaaaacaacccc
gaagtaatgtcacacctcgttcatcagcttggtctctctccctccctaggcttcacagac
gtcttctccatcgacgagccagaccttctcgcgcttgtgccgcgcccttcccaagctctc
ctcctcgtattccctgtctcaaaaagctacgaatccagtcgtatcgccgaggacagctct
ctccctgagtacacgggctccggaccaaatgagcccgtaatgtggttcaaacagacaatt
cggaacgcgtgcgggctgattgggctcctacacgctgtgtcaaatggcgaggcaaggaaa
catattctgccaggctcagatcttgagaatctgctaaaagaggcggagaagctagatccg
atcagacgggcagatctgctgtacgaaagtaaggcgttggagagtgcacatgctgatgca
gcgaaattgggggataccaaggcgcctggggcggaagatgacgtggatctgcattttgtg
gcatttgtaaagggggaggatgggaggctgtgggagcttgatgggcggaggaggggcccg
ttggagaggggggtacttggagatgaggaggatgccttgagtgaaagggcgttagagtta
ggggtcagaaggttcttggatgttgaggctaaaggagggaatccggatttacggttcagc
cttgtcagcttgggggctgtctttgattga

DBGET integrated database retrieval system