KEGG   Aspergillus nidulans: AN7521.2Help
Entry
AN7521.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
ani  Aspergillus nidulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 560 aa AA seqDB search
MATSRPTSTSTWSRLALALSASFIPLPAYAQLYDKVIQTEYGPVKGFKYFNKSTLEKNWG
SSADGSNVAAFLSIPFAADTAYENRWKPPQPREPWNETLVADTWGPGCPTSYATDYSEDC
LTVNIWTGANSSSDRLPVMIYNQGSDEPSNSAVYYGGGVARKGVVAVTFNRRDDVFGYLA
HPELNAESEKENGHSSSGNYGILDFLELLKWVQRNIENFGGDSTSVTIVGQSFGSAQVYH
AVNSGLFKGLFHGAIAESGVRYPYDTLLAGLADSYVTMPKAIQNGLNYTASHNASSIADL
RKLSTEEIMVGSGDRVTDADIWWVTALSCMYPLKYKPVLDGYVLPEKYIDSLRNGPANDV
PFITGNNKDESGAATSTDYTAKEYHEYASLKYGNLSSRYFALYPGNNETQASRSWNAAAR
DTSLVSSWLFAKDWAKSASSPFYTYYWDHAPPSQTQGAYHESEVFYTMDTLYANADDHEW
TWYDYHVAEIMSSYWVNFVKTGDPNLGGTYPWKNLTYWAPVGSGKNETVFHVGDGFGEVP
LAKHEQVELITEYFSRQVPY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggctacctccaggcctacctcaacctcgacctggtccaggcttgcactcgccttgtcc
gcctcattcatccccctcccagcttacgctcagctttacgataaagtaatccagaccgag
tacggccctgtcaagggcttcaaatacttcaacaagtcgaccctggagaaaaattggggg
agttccgctgacggcagcaacgttgcagcctttctctccatcccctttgccgccgacact
gcgtacgagaaccgctggaaaccgcctcaaccgcgcgagccctggaatgagaccctcgtc
gcggatacctggggccctggctgcccgacctcttacgcaacggactacagcgaggactgt
ctcactgtgaacatctggacgggcgcgaattcctcgtctgacagactgcccgtcatgatc
tacaatcagggcagtgacgagccgagcaacagcgctgtttactatggcggtggcgtggcg
cggaaaggcgttgtcgctgtgacattcaaccgccgtgacgatgtctttgggtacctggcg
caccccgaattgaatgccgagtcggagaaagaaaatggccacagctcgtcaggcaactac
ggaatcctcgacttcctcgagctgctgaagtgggtgcagcgcaacatcgagaacttcggc
ggcgactctacgagcgtcacgatagtcggacagtccttcggctccgcgcaggtctaccac
gccgtcaacagcgggctcttcaagggtctcttccatggagctattgccgagagtggcgtg
cgatacccctacgacacccttcttgccgggctcgcagattcgtacgtcaccatgccgaaa
gctatacagaatggtctcaactacacagcctcgcacaatgccagctcaatcgcggacctg
cgcaagctctccaccgaggagatcatggtcggctcgggtgaccgtgtcacagatgccgat
atctggtgggtgactgcgctctcctgcatgtacccgctcaaatacaagcccgtgctagac
ggctacgtcctccctgagaagtacatcgatagcctgcgcaatgggccggctaatgacgtc
ccctttatcaccggcaacaacaaagacgagagcggtgctgcgacgtcgacagactacacg
gctaaggagtaccacgagtacgccagtctcaagtacggcaacctctcatcccggtatttc
gctctttaccccggcaacaacgagacgcaagcgagccggtcctggaacgctgcggcaaga
gatacgtcgcttgtctcgtcctggctgttcgcgaaggactgggccaagtctgcatctagc
ccgttctacacatactactgggaccacgccccacctagccagacccagggtgcgtaccat
gaatctgaagttttctacaccatggacacgctgtatgcgaacgcagacgatcacgagtgg
acgtggtatgattaccatgtcgcggagatcatgtccagttactgggttaactttgtcaag
acgggagatcccaacctcggtggaacttatccatggaaaaacctgacgtattgggctcct
gtgggcagtgggaagaatgagacggtgttccatgtgggtgatggctttggggaggttccg
ttggccaagcacgagcaggtggagttgattacagagtacttttcaaggcaggtgccatac
tag

DBGET integrated database retrieval system