KEGG   Aspergillus nidulans: AN7624.2Help
Entry
AN7624.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ani  Aspergillus nidulans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AN7624.2
  Lipid metabolism
   00561 Glycerolipid metabolism
    AN7624.2
   00600 Sphingolipid metabolism
    AN7624.2
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AN7624.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AN7624.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 469 aa AA seqDB search
MIEFLALITLISRANALMRPDGVGRLPALGWSSWNAHECDINATVILTAAAQVVKLGLKD
LGYEYINNHAFREDNTSNSCPVDDCWSIKTHRDPTTNRMIPDADRFPDGIASVASQIHEL
GLKVGIYSSAGETTCAGYPASLGYEDIDAETFAEWEIDYLKYDDCGVPDNWKDPYTFCVP
DTANNAGPFPNGTCPSLPNPAPANYNWSTSPSAERFRRMLDALNTQDRTILYSLCNWGNA
AVNTWGAEIGNSWRMSGDISPGRGEVGPDRTRIAVWERIAEITNEMSFLVREYAEFWGWP
DADMLEVGNGEGGMTVAENRAHFALWAAMRSPLLIGTKLDTIRQEHLKILKNPTLLTFHQ
DPIINRPAYPYKWGYNADYTFDAAHPAEYWSGPSPALEGTLVVMLNSENVTSTRMAVWSE
VPELQNQDQGDAFEVMDGWTGEDLGCIKEKYEVELDAHDAAVLVVGNAC
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtttctagcactgatcaccctgatttcccgagccaacgcgctcatgaggcct
gacggagtgggccgcctcccagctctaggttggagctcttggaatgcgcacgagtgtgac
atcaacgcaactgtaattctgactgccgcagcgcaagtcgtgaagttaggactcaaggat
ttgggctatgaatatatcaacaatcacgctttccgagaggacaacacttctaacagctgc
ccagtcgacgactgctggtccataaaaacccaccgcgaccccaccacaaaccgaatgatc
ccagacgcagatcgatttcctgacggaatcgccagcgtagcatcgcagatccatgagcta
ggcctgaaagttggaatatacagcagcgcgggtgaaacaacgtgcgccgggtacccagct
agtctggggtatgaggatatcgatgcggagacgtttgctgagtgggagattgactacctg
aaatacgacgactgcggggtcccagataactggaaagacccatacactttctgcgtcccc
gacacagccaacaacgccgggccttttccgaacggcacttgtcccagcctacccaatccc
gcaccggcaaactacaactggagcacatcccccagcgccgaacgctttcgccgcatgctt
gatgccctcaatacccaggaccgaacaattctctactccctctgcaactggggcaacgca
gcagtgaacacctggggcgctgagattgggaactcatggcgcatgagcggggatatctct
ccggggcgcggggaagtagggcccgacagaaccaggattgcagtctgggagagaattgcg
gagattacgaatgagatgagttttcttgttagagagtatgcggagttttggggatggcct
gatgcagatatgcttgaggtggggaacggcgaaggggggatgacggtggcggagaacaga
gcgcattttgcgctttgggcggcgatgaggagcccccttctgattgggacgaaacttgat
acaatcagacaagagcacctgaaaattcttaagaaccctactctcctaacattccatcaa
gaccccatcatcaaccgcccggcttacccctacaaatggggttacaatgcagactacact
ttcgacgccgcccatccagcagaatactggtctggaccctcgcctgcgctagaaggcacg
ttggtcgtcatgctcaactccgagaatgtcacgagcacgcgcatggctgtttggagcgag
gtcccggagttacagaatcaagaccaaggagatgcgttcgaggtcatggatgggtggaca
ggcgaggatcttggttgcattaaagagaagtatgaggtcgagcttgacgcgcacgatgcg
gcggtcttggttgttgggaatgcttgctga

DBGET integrated database retrieval system