KEGG   Aspergillus nidulans: AN7678.2Help
Entry
AN7678.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
ani  Aspergillus nidulans
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AN7678.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AN7678.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AN7678.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 1452 aa AA seqDB search
MPEKLSDQHTAGKGQLRQVQSRPSSPLGNENAALADPTTPGRRRLQKHSSTTFLTDASSN
NFAGSRLSNLSKRRLSIRDQRVPQGPRPQEQPRSSGAVHHSGNSSVDSTTGSLKNSNSRI
SLRSTSMSNLANQNTAENMEFLAPVNFDDFHNSIIAEPSLNHFPLPTTGGTGNDRQSTSF
HPTNPWAKNNIDNNTPGPAKGYPSRRKSLIGQNISSDSSSRPQASTAAGRNRRQSLIQNQ
APDNPTPRAPRKSIGPGFLPTASSARRQSLSSRKASADTTRPDQTSYLRPRSQHHEMNGF
NGPRLPSNARSAKAKSFQPPSSELGDNFLTTTGLGDHSRSSSTNAVRTPMKSTAGRVPTP
TSSAKRVSVMPLHATGLGARTISPTDARRLKRLSTAPQAHPLPNTPPSQTEPLPHRPRSS
TYSPSNIPRKSATPSSNRTTPDPNRKSYSSGLSLSSNTSYNSARNSGGSLQTRLSQNFSS
SRLPTPKPRVEHAMNNAEEVPPVPAIPKAYESPKGESDQPQFSAPRKSSLPLEIELLRST
HISESKSTSGQRNSEVLDERGIKTPEAKPHTSVAFGKKNMKLPPLNLLPLGTPMTSKIEA
LVDKDDHTDPSTPSAQHVSKTPSTPLTASKANYFSFRDDEDADPLPQARSSTSHFALSTS
SSITLRAASSSSALASHDGHTPGGARTVSPYVSYALPKSNSEYNHLRQKPSADYSSRISQ
SYKLTGPRPQTRSSGLSNSETVSIPSDPDSNGLPTTTLRNKITLSRKRSTSKTQQALNAN
TDPKKSDLMPPPKLPASATWNNLSTGKDSSPTLKPSYLKSRRQSSLTNVANPALRKPSFS
SEQSLSLSPTVSRESHESDNSQHRSASSILSPVHKIISSAKSNMAATSQTENRIETEIAI
ADEEMRRLGTKRKDFEKAARELDELRNRAGPKDHVNPAQALRVAHLNIFERGEIIDFKDI
YFCGTQDAKKHVGDLNQQSTNFGYDDDRGDYNIVLGDHLAYRYEVVDVLGKGSFGQVVRC
IDHKTGNLVAVKIIRNKKRFHQQALIEVNLLQKLKEWDPHRRHNVVNFTQSFYFRGHLCI
STELLGINLYEFIKAHDFRGFGIKLIRRFTRQILNTLTLLQAKKVIHCDLKPENILLVHP
LSSEIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGY
PIFPGENEQEQLACIMEVFGPPEKHLIEKSTRRKLFFDSLGKPRITVSSKGRRRRPSSKE
LRQVLKCDDEAFLDFISRCLRWDPQRRLTPSEALRHEFMTGHRMAPRPRPFGSQSPGKRA
NTLSTPTTGRPLPEPPGTSLKNGAVVRSRDPSNPSPIKATAGKRHSTVSGLPPSTPAKRG
INLTTTPGSALPRASARSISGKPDLATAAAATSLLHSRPGTLVDLIRFLRLILTAGSTSQ
WMRQDTSSYTLT
NT seq 4359 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaagctgtcggaccagcacactgcaggaaaggggcagttgcgtcaagtgcag
tccagaccgtctagtccgctgggaaatgagaacgccgcgttggccgatcctactactcct
ggccgcagacggttacaaaagcactcttcaacgaccttcctaaccgatgcctcctctaat
aattttgccggatctagactgagtaacttgagcaagcggaggctctctattcgcgatcag
agggtgccccaaggcccgcgcccacaagagcaaccacgcagttcgggcgcggttcaccac
tctggcaactcctccgttgactcgacgaccggatctctaaagaacagcaattcacgtatt
agcctgcgttccacgagcatgagtaatctcgctaaccagaatactgccgagaatatggag
ttccttgctcccgttaacttcgacgactttcataatagcattatagcagaaccgagcttg
aaccattttcctttgcctacgaccggaggaactggaaatgaccgacaatcaacctctttc
catcccaccaatccatgggcaaaaaataatattgataataatacgcctggaccagctaaa
ggctacccgtcacggagaaagagcttgatagggcagaatatttcctcggactcgtcttcc
cgcccgcaggcatcaactgcagccggtcgaaatcgtcgccagagccttatacaaaaccag
gcgcctgataatcctacaccgcgagcgccgcgcaaatcaattgggcccggttttttacct
acagcttcctctgcgaggcgccaaagtctatcatccagaaaagccagtgctgacacaact
cggccggaccaaacaagctatctccgcccaagaagccagcatcatgaaatgaatgggttc
aacgggccgcggcttccgtcgaatgctcgcagtgcgaaggccaagtcctttcaacctccc
tcaagcgaacttggcgataatttcttaacgactaccggcttgggggatcactctcgttcc
tcatcaaccaatgctgttcgaaccccaatgaagagcacagctgggagggttccaacacca
acgtcatctgcaaagcgagtatccgtgatgcctctccatgcgacaggccttggtgctcgt
acaattagtccgactgatgctcggcggctgaagcgcctctcaacggcaccccaagctcac
ccactgccgaatacaccgccgagccaaactgaacccctgccacatcgtcctcgctcctca
acttactccccttccaacattccccgcaaaagtgccaccccctcctccaatcgcactact
cctgatccgaatagaaaatcctacagttcaggcttgtctctgtcgtcgaataccagttat
aactctgcgagaaattcgggcggctcactgcaaaccagattgtctcagaatttctcatct
tctcggcttccgaccccaaagcctcgtgtggagcatgccatgaataatgctgaagaggtg
ccgccagttcctgctattcccaaagcctatgaatccccgaagggcgagtcggaccagcca
caattctcggcaccccgcaagtctagtttgcctctggaaattgagctcttgagatccacc
catatctccgagtcaaagtcaaccagcggccagcgtaactctgaggtcttggatgaacgc
ggaataaaaaccccggaagccaaaccgcataccagtgttgcgttcggtaagaaaaacatg
aagctgccaccgttgaacctacttcccttgggaacaccgatgacttccaagatcgaggca
ttggttgacaaagacgatcatacggacccatcaactccatccgcacaacacgtatccaaa
acaccgagcactcctttgaccgcctcaaaagcaaactacttttcttttcgtgacgatgaa
gatgcagatcctcttcctcaagcacggagcagcacgtcgcattttgcactaagtacatcg
tctagcatcaccttaagggctgctagcagttctagtgcacttgcttctcacgacggtcat
acgcctggtggagccagaactgtctctccgtacgtttcttatgcactgccgaagagcaac
agcgagtataatcatctccgtcagaaacccagcgcagattactcttcccgtatatctcag
tcgtacaaattgaccggtcctcgtcctcaaacccgatcttctggactctcgaactcggag
accgtttctatcccttccgatcctgatagcaatggactgcccaccactactctgcgcaac
aaaatcaccttgtcgcgcaagcggagcacttcgaaaactcagcaagcgctcaatgcaaat
acagaccccaaaaagtctgacttgatgcctcctcctaagctcccggcttccgccacctgg
aacaacctttcgacaggaaaggattcgagtccgaccctaaagccatcatacctcaagtct
aggcggcaatcttctttaactaatgtggcaaatccagcgctcagaaaaccgagcttcagc
agcgagcagagcctgtcactatcacctactgtctctcgggagtctcatgaaagcgataac
tcccaacatcggtctgcgtcttcaattctctcgccggtgcacaagattatcagctcagcg
aagtcaaatatggcagccacttcgcaaactgagaaccgaattgagacagagattgcgatc
gcggacgaggaaatgcgaagattaggcaccaagcggaaggattttgaaaaagctgcaagg
gagttggatgaattgcgcaacagggccggacctaaggatcatgtcaatccggctcaggct
ctgagagtagcccatctcaacatctttgagcgtggggaaattatcgactttaaagacatt
tacttttgcggtacccaagatgcaaagaagcacgtcggagatctgaaccaacaatcaacg
aactttggttacgatgatgaccgcggagactacaatattgttctaggtgaccatttggcc
taccgctatgaagtggttgatgttctgggtaaaggtagctttggtcaagttgtccggtgt
atcgaccacaaaacgggcaacctggttgcagtgaagattatccgcaacaagaaaaggttc
caccaacaagctctaattgaggtcaaccttcttcagaagctcaaagagtgggatccgcat
cgccgtcataacgtggtcaatttcacgcagagtttctactttcggggacatctgtgcatc
tcaactgaactgctgggtatcaacctgtacgagtttatcaaggcgcacgatttcaggggg
tttggtatcaagctgatccgtcgattcacgaggcaaatacttaataccctcacgcttttg
caggcgaagaaggttattcattgtgaccttaaacctgagaacattctccttgtccatcct
ctcagttcggagatccgggtcatcgactttgggtccagctgtttcgagaacgaaaaggta
tacacgtacatccagagtcgcttctaccggtctcctgaggttatccttggtatgtcttac
ggcatgccaatcgacatgtggagtttgggatgcatattggcggagctttacaccggctat
cccatcttccccggcgaaaacgaacaagagcagcttgcctgcatcatggaggtctttggg
ccgccggagaagcacttgattgagaagagcactcggaggaagctcttctttgattctctc
ggcaagccgagaattacagtatcgtccaaggggcggaggcgacgccctagctcaaaagag
ctccggcaggttttgaagtgtgacgatgaggcatttttggacttcatctcccgttgcctt
cgatgggatcctcaacgccgtttaactcccagcgaagctctacgacatgaattcatgacg
ggtcacagaatggcgcccaggccgagaccctttggaagccagtccccaggaaagcgggcg
aatactttgtccacgccgacaacgggtcgacctctcccagaaccgcccggcacaagtctc
aaaaatggcgccgttgtccgcagccgcgacccttcgaatccgtcgccaataaaagcgaca
gctggcaagcgtcactcgactgtcagcggattgcctccgtcaacgcccgccaagcgaggg
ataaatctaacgactacaccagggtccgcattgcctcgtgcttctgcgagaagcatcagc
gggaagcctgaccttgcgacagcggcggcggcgacaagcttgttgcatagcaggccgggg
acgcttgtggatttgattcgattcttacgacttatattgactgctggttcaacaagccag
tggatgaggcaggacacttcttcttataccctcacttga

DBGET integrated database retrieval system