KEGG   Aspergillus nidulans: AN7792.2Help
Entry
AN7792.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ani  Aspergillus nidulans
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ani00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 618 aa AA seqDB search
MKLTSVFSLAAAGLSSATPLFIDITPRALPNAPDGYAPVNVTCPAVRPSIRSAASLSPNE
TKWLEPRRKEIISPMKNLLTRLNISDFDAAAYLDRVSANSSNIPTVGIAVSGGGYRAMLN
GAGALKAFDSRTANSTAESQLGGLLQSATYLSALSGGGWLVGSVFINNFTTIDALQSSDR
IWDLRTNVLEGPNVKHFQLLSTAEYWSDLVEAVHSRKHAGFNTSITDYWGRALSYQFINA
SDGGPSYTWSSIALMDNFKNGQVPLPLLVADGRNPGELVVGSNSTVYEFSPWEFGTFDPA
IYAFAPLEYLGSDFTANGSCVRGFDNAGFVMGTSSSLFNQGLLRLNSTSIPETFKKALAS
ILEAVGQANEDIASYPNPFKGYQGSTAAISAISELNIVDGGEDGQNIPFHPLIQPARQVD
VIFAIDSTANIHNWPNGKSLVRTYERSLNSTGVGNGTVFPTIPDTNTFINLGLNQRPTFF
GCDAKNLTGPAPLIVYLPNAPYTHMSNTSTFDLSYSYADRDAMILNGYNVATRGNGTVDR
QWPACVGCAILSRSANRTGTSLPDACTQCFQNYCWNGTIDSRQPQDYAPALMIKTSAAGT
IRPWGFSVLLLALLTWTW
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacctcagttttctctctggctgccgctggcctgagcagcgcaactccactc
ttcatcgacatcaccccccgagccctcccaaatgcacccgacggatacgctccggtcaat
gtcacctgtccggctgtgagaccgtcgatccggagtgcagcaagtctgtcgccaaacgag
acgaaatggctagagcctcgtcgcaaggagatcatctcgccaatgaaaaatctcctcact
cggttgaatatttctgatttcgatgcggcggcctatcttgaccgggtatctgccaactcc
tccaatatccctaccgtcgggatcgcggtctcagggggcggataccgggccatgctgaac
ggggctggagccctcaaggcctttgatagtcggacagcaaactcgacggccgagagccag
ctcggcgggcttctccagtcagcgacgtatctctcagctctcagtggaggcggctggttg
gtcgggtctgtcttcatcaacaacttcaccactatcgatgcacttcaatccagcgatcgg
atctgggatctgcggaccaatgtcctcgaagggccgaatgtcaaacactttcagctcctg
tctacggcagagtactggagcgacctggtagaagcagttcactcaaggaagcacgccggc
ttcaacacttccatcaccgactactggggacgggcgctctcgtaccagttcattaacgcg
tcagacggcgggcccagctacacttggtcgtccattgcgttgatggataactttaagaac
ggccaggtcccgctgccccttctcgtagccgacggccggaatccaggggaattggtggtc
gggtcgaactcgacagtgtatgagtttagcccgtgggagtttggcacttttgacccggcc
atctatgcctttgcgccactcgaatatctcggctccgactttacggcgaatggatcctgt
gtgaggggattcgataatgccgggttcgttatgggcacctcgtctagcctcttcaatcag
gggctactccgcctgaatagcacgtctatccccgagacctttaagaaggcgctcgcgtcg
atccttgaagcagttgggcaggcaaacgaagatatcgccagctacccgaatcccttcaag
ggctatcagggcagcaccgcggccatttcagccatcagcgagctcaacatcgttgacggc
ggcgaagacggccaaaacatcccctttcacccactcattcagccggccagacaggtagac
gtcatcttcgcgatcgactcgacggccaacattcacaactggccgaatgggaagagcctg
gttcggacgtacgagcgcagcctgaactcgaccggcgttggcaatgggacggtcttccca
acgatcccagacaccaacaccttcataaatctgggcttgaatcagcggccgactttcttc
ggatgcgatgcgaagaatctgaccggccctgcaccgttgatcgtctaccttcccaatgca
ccgtacacgcacatgtcgaatacctccacatttgacctgagctacagctatgccgaccgc
gacgccatgatcctaaacgggtacaatgtcgccacacgcggaaacggaacagtggatagg
cagtggcctgcgtgcgtggggtgcgcgattcttagccggtctgcgaataggacggggacc
tcgctgcccgatgcttgcacgcagtgctttcagaactactgctggaatggcacaattgat
agtcgccagccacaagattatgcgcctgcactcatgatcaagacgagtgcagcggggacg
atcaggccttgggggttttcagtgctgctattggctctgttgacttggacgtggtag

DBGET integrated database retrieval system