KEGG   Aspergillus nidulans: AN7995.2Help
Entry
AN7995.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ani  Aspergillus nidulans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AN7995.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AN7995.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 379 aa AA seqDB search
MPPTIRVIGSLNADMVSVTPRFPDAGETITSSSYFTSAGGKGANQAVACGRLSRSQPQSS
SFSTSINTGDVNVEMVGAVGGLDGHFSALLKPTLEKSGVDTSRVKVVEDAYTGVAVIIVD
SSAGGENRILFSPGANYSGMQADPSVVGMALAEPAPDVIVMQGEIPTETTVAILREIARW
KEQQRADGKRGIDAGPDVMFNPAPAPPGGLPEDVYKGVDHLIMNETEAELMTPDEDVLLR
VPGIESAQDGKEKVARYFHSLGVRYVIVTLGAKGVWYSAADPDTLGDRVVNEVPAAKVSR
VLDTTAAGDTFVGAYAVQAARWREGRRREGKAGKDLDAEEKKHRYKNVMDEAMGVATRAS
ARGVERQGAMDSIPWENEI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctacgatccgcgtcatcggctctctaaacgccgacatggtctccgtaacgcca
cgcttcccagacgcgggcgaaacaatcacctcttcttcatatttcacaagtgcaggcggg
aaaggcgcaaaccaagccgttgcgtgtgggcgactctcgcgttcgcagccgcaatcctcc
tctttctcgacaagcataaacactggcgacgtgaacgtcgaaatggttggcgcagtggga
ggactagacggccacttttccgcacttctcaagcccaccctggagaaatccggtgtcgat
acgtcacgcgtgaaggttgtggaagacgcatatacaggtgtggccgttataattgtggac
tcatccgccggcggcgagaacaggatcttgttttcgccgggcgcaaattactcggggatg
caggccgacccgtcagttgttggcatggcgcttgcggagccagctccggatgtcattgtc
atgcagggcgagattcccaccgagacgacggtcgcgattctccgcgagatcgcgcggtgg
aaggaacagcagcgcgcggatgggaagagggggattgatgctggcccggacgtgatgttt
aaccctgcgcctgcgccgcctggaggcttaccggaggatgtgtacaagggcgttgaccac
cttatcatgaacgagacggaggctgagctcatgacaccggacgaggacgtgctgctgcgc
gttccgggcattgaaagcgcgcaggacgggaaggagaaggttgcgcggtacttccatagc
ctcggcgtaagatatgtgattgttacgctgggggcgaagggggtgtggtatagtgctgcg
gatccggatactctaggggaccgggtcgtgaatgaggtccctgctgcgaaagtgagcagg
gtgcttgatacgacggcggcgggcgatactttcgtgggagcctatgcagttcaggctgca
agatggcgtgagggaaggcgccgggaaggaaaggctgggaaggaccttgacgctgaggag
aagaagcataggtacaaaaatgtcatggatgaggcgatgggtgtggccacgagggcttcg
gcaagaggcgtagaaaggcagggtgcgatggatagtattccgtgggaaaatgagatctag

DBGET integrated database retrieval system