KEGG   Aspergillus nidulans: AN8042.2Help
Entry
AN8042.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AN8042.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AN8042.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 744 aa AA seqDB search
MVDDEDIIMGEAGYHSANPNTAIAAGQQTTHGHLNGRSDPYLAPPLLSQPMQMPVVQAGN
SQTQESSATTDEARVLSPKIDLNSTVPADAADITPDYQDSLVDEYSDYAEESKEAPGLPL
ASLPSGLCYDVQMRYHCEVRPTSDVHPEDPRRIYYIYKELCRAGLVDDIESTRPLVARPL
KRIHARNATEEEISLVHTAAHYAFVESTKDMSDEELIALEHTRDSIYFNNLTFASSLLSV
GGAIETCLAVATRKVKNAIAVIRPPGHHAEHDKTMGFCLFNNVQLKETNHSRDVHHGNGI
QKAFYDDPNVLYISLHVYQNGSFYPGEKDGDADFCGAGAGEGNQGMGDGDYIYAFHQVVM
PIAQEFDPDLVIIASGFDAAAGDTLGGCFVTPACYAHMTHMLMTLAQGKVAVCLEGGYNF
RSISKSALAVTKTLMGNPPDRLSFTCPSEAAISTIRRVSSIQSDYWKCMYPKAIKNEGVW
TDRLHDIIRAYQAKQLYDNYKLTSLYIYRTAISKSFENQVLARPEIMGLPHPLTNNLEAH
NCWLADVMKDYVQWAVGKGYAVIDVNIPKHVTTEPSSGRFEEEDENRPTATEELAGYLWD
NYIDPNEATEIFLVGIGNAFYGVANLLINRETLYQRVNGVISFVAKDPVRAVASHTQVWL
SRWYRDNSLVFVSKAHGVWKSDRKATKRYGKLIQSSREGLSDMLMHHKDEVFQWIEDRIE
PESEETEEEKPVKRSPTKAAPKAA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggtagatgatgaggacatcattatgggggaggcagggtaccactctgccaatcccaac
acagcaattgctgccggtcagcagacaacacacggccatttaaacggcagatctgatcca
tatctggcgccaccgcttctcagccaaccgatgcagatgcctgtggttcaggctggtaac
tcgcagacccaagaatcatctgccacgacagatgaagcgagggtcttgtcaccgaagatt
gacctgaactcaaccgtccctgcagatgctgcagatatcactcctgactaccaggacagt
ctcgttgatgagtactcagattatgctgaggaaagcaaagaagcgcctggacttccactt
gcttcattgccgtcaggactttgttacgatgttcagatgcgctatcattgtgaagtccga
ccaacctcagatgtgcatccggaagatccaagaagaatctactatatttacaaagagctc
tgccgggcaggactggttgatgacatcgaatcaaccaggcctcttgtggcacgcccactg
aagcggattcatgctcgcaatgccaccgaggaagaaatctctttagttcacaccgcggca
cattatgcattcgtagagagcacaaaggatatgtctgatgaggaactgattgccttggag
catactcgagattcaatttacttcaataatctcaccttcgcatcgtccttgctatctgtc
ggcggcgccattgaaacttgcctagccgtagctactcgcaaggtaaagaacgcaattgct
gttattcgaccaccggggcaccacgccgagcacgataagacaatgggattctgcttattt
aataatgtgcaattgaaagaaactaaccatagcagggacgtccatcatggaaacggaata
cagaaggcgttttatgacgatcccaacgtcctgtacatttcgcttcatgtctaccaaaac
ggaagtttctatcccggggagaaggatggcgacgcggatttctgtggcgctggagcgggt
gaaggaaatcaaggaatgggtgatggggactacatatatgcctttcaccaggtcgtcatg
ccgattgcccaggagtttgaccctgatttggttataattgcgtctggttttgatgctgct
gcgggagatacgcttggaggatgctttgtcaccccggcgtgctatgctcatatgacgcat
atgttgatgacgctggctcaaggcaaggttgctgtttgcttggagggtggctataatttt
aggtcgatttcgaagtctgctctcgctgttacgaagacactcatgggaaatccgcctgac
cgactatccttcacctgcccttcagaagcggccatttctaccatacggcgagtatcgtcc
atccagtccgactactggaagtgcatgtatcccaaggcaataaagaatgaaggagtctgg
actgataggcttcacgatatcattcgagcttaccaggccaagcagctctatgacaactat
aagctcacctctctctatatctaccgcactgctatatcgaaatcattcgagaatcaggtt
ttggcaaggcctgagattatgggattgccacatccattaaccaacaacttggaggcgcac
aactgctggctagctgatgtaatgaaggattatgtccaatgggctgttggcaagggttac
gctgtgattgacgtaaatattcctaaacatgtcacaactgaaccttcatcaggcaggttc
gaggaagaagacgagaatcgaccgacagcgacggaagaactggccgggtatttgtgggat
aattacatcgacccaaatgaagcaaccgagatattcctcgttggtattggaaatgctttc
tatggagttgccaacctcttaatcaatagagaaaccctttaccagcgagttaacggtgtc
atttcattcgttgctaaagacccagtccgtgcagtggcctcgcatactcaagtctggtta
tccagatggtaccgagataactcactcgtttttgtctcaaaggcgcatggtgtctggaag
agtgaccgcaaggcaaccaagcgctatgggaaacttattcagtcatccagggaaggactt
agtgacatgcttatgcaccacaaagatgaggttttccaatggatcgaagatcgtattgag
cctgagagcgaggagacggaggaggagaagccggtcaagcgttcacctaccaaggccgct
cccaaagcggcctga

DBGET integrated database retrieval system