KEGG   Aspergillus nidulans: AN8169.2Help
Entry
AN8169.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AN8169.2
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     AN8169.2
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     AN8169.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 543 aa AA seqDB search
MVAADDTIPELAEGHMEPPVPESRVLIIMTGGTICMRPSPAGLVPARDFQKQCLARVPTF
NDGSNSTMMDVVTNAVGEIKAHVSLRTPLTAYGRRVRYTVFEFDELLDSSSIDAKGWSEI
ARTIERNYTLFDGFVVLHGTDSLAYTCSALSFMLQNLGKPVILTGAQAPMLELQNDATDN
LLGSLVVAGHFMIPEVAASDFNAFNSPNCAPLAVTTSMRTNVNWEIVNRPNSIEHFSIQT
NLDTTHVACLRIFPGIKPEMVDAVLKLEGLRGLVLETFGAGNAPHGQDNAMTKVLADAIA
RGIVIVNVTQCLTGSVSPVYAPGMSLSKAGVVAGLDMTTEAALTKLAYLLALPGADPKLV
ASKMSVSLRGELTESSQPVFRHPDGALPERVQALTILGYAIAQGDLARVEELLKSEHHWL
LNDADYSGNTPMHLAATSPSVDILRFLLLQGGSVHLRNRNGRTPLFLAANAGLSEHVLLL
RKSGAHLHSDERTAAQLLARRRPGIWGLAGIGPREISDREMEEVDGDGYRAGSSHWPMAG
SAP
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgccgatgatacgattccagaattggccgaaggccacatggaacccccagtg
cccgagtctcgggtgctgatcatcatgactgggggtactatctgtatgcgaccgtcgcca
gcgggcttagtaccagcacgagacttccagaaacaatgcctggctcgtgtgccgacattc
aacgatgggtcgaactctactatgatggatgtggtgaccaacgccgtgggggagatcaag
gctcatgtgagtctgcggactccgctgacagcatacggccggcgagtgaggtacactgtc
tttgaattcgatgagctgctcgacagcagctccatcgacgctaagggctggtctgagatt
gcgcggaccattgagcgaaactacacactgttcgacggcttcgtcgtgctccatgggacg
gacagtctggcgtatacctgctcggcgctgagcttcatgctgcagaacctcggaaagccg
gtgatcctcacaggagcccaggctccgatgctggagctacagaacgacgctacagataac
ctactcgggtcactggttgtggctggccacttcatgattccagaggtagcggccagcgac
ttcaatgcctttaattcgcccaactgcgcgccgctggctgtcacgacgtcgatgcgcacg
aatgtcaactgggaaatcgtgaaccggccgaacagcattgagcattttagcatccagaca
aacctggacacgacgcatgtcgcctgtctccgtatcttcccaggtatcaagccggagatg
gtggatgcggtgttgaagctggagggcttgcgtgggctggtcctggaaacgtttggcgct
gggaacgcgccccacggccaggacaatgccatgaccaaggtgcttgctgacgcgatcgcg
cgagggatcgtcatcgtcaatgtcactcaatgtctgaccggtagtgtcagccccgtgtat
gctcccggcatgagtctctccaaggccggtgtcgtcgcgggattagacatgaccacagaa
gctgccctaaccaagctggcttacctgctggcgctccccggggcggaccccaagctcgtg
gcgagcaagatgtccgtctctctgcgcggcgagctgaccgagtcgtcgcagccagtcttc
cgccatccggatggagctctgcccgagcgcgttcaggcgctcactatattgggatacgcc
atcgcgcagggggaccttgctcgcgttgaagagctcttgaagagcgagcatcactggctg
ctgaacgatgctgactattccggaaacactccaatgcatctggcagcaacatcaccgtcc
gtagatattctgcgattcctgctgcttcagggcgggtcggtgcatctgcggaatcgcaac
ggacgcaccccgctcttcctggccgctaatgctggactgtccgaacacgtgcttctactg
cggaagtcgggcgcgcacctgcactctgacgagcggacggccgcacagctgctggcgcga
cgacggcctggcatctggggactggccggcattgggccacgtgaaatcagcgacagagag
atggaggaagtcgacggggacgggtaccgcgcagggtcgtcgcactggccgatggcggga
tctgcgccttga

DBGET integrated database retrieval system