KEGG   Aspergillus nidulans: AN8191.2Help
Entry
AN8191.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ani  Aspergillus nidulans
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AN8191.2
Translation factors [BR:ani03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AN8191.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 350 aa AA seqDB search
MENANLWTRRNNTSKLSLSMAGTDNKEGGARVDLSRTSKRFGPDSSHGRSNPFNALSPLS
AGVSSPSTNASSAFGLGSGAFASFGAPKTPGGSSEVKTPGERRENPTDRTASSAEGIKSK
ASEPHLKEHVLRSTWIIWYRPPTPKYSDYEKSTAPLASIHSVESFWSVYSHLKRPSLLPT
VSDYHIFKKGIRPVWEDEANKKGGKWIVRLKKGVADRYWEDLLLAMIGDQFAEASDEICG
AVLSVRSGEDVLAVWTRIDGGRNIKIRETIKRLLAFPADTNIVWKSHDDSIAQRSAIDQA
RQEKAANNHHHHHNHHNHHHNQNPHHQYGGDRRRPTADDSTGDKGKGPAS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgaacctgtggactcgccgaaacaacacctcgaagctttctctgtcaatg
gcagggactgacaacaaagagggtggcgccagagttgacctttcccgcacatcaaagcgc
tttggccccgacagctcccatggccggtccaatccttttaacgctctttctcccctgtct
gcgggcgtgtcctctccatctacgaatgcgtcatctgcctttggcctcggttccggtgcg
ttcgcctcgttcggggcgcccaaaacacccggaggttcgtcggaggtgaagactcctgga
gaaaggagggagaatcccactgatcggacggcatcatccgcggagggtatcaagtcgaag
gcttctgaaccccatctcaaggagcacgtcctgcgatccacttggattatctggtaccgt
cctcctacccccaaatattccgactatgagaagtccaccgcaccgctcgcctcaatccat
tcggttgagagcttttggtcggtatactcgcacctcaaaaggccttcgctccttcctacc
gtttccgactatcatatctttaagaaggggattcggccggtatgggaagacgaggccaat
aagaagggcggaaaatggattgtcagactgaagaagggagtggcggaccgatattgggag
gatcttctcctggccatgattggtgatcagtttgcggaggccagtgacgaaatctgcggc
gctgttctcagtgtgcgaagtggtgaagatgttttggccgtttggacccggatcgacggt
gggcgaaacatcaagatcagagagaccattaaacggttgctcgccttccccgcagacacc
aacattgtctggaagagccacgatgacagcattgcccaacgctccgctattgatcaggct
cgacaagagaaggccgctaacaaccaccatcatcaccacaaccatcataatcaccatcac
aaccagaaccctcatcatcagtatggtggagaccgccgaaggccaacggctgatgactcc
acgggagataagggaaagggaccggcatcttga

DBGET integrated database retrieval system