KEGG   Aspergillus nidulans: AN8755.2Help
Entry
AN8755.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ani  Aspergillus nidulans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ani01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ani00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 613 aa AA seqDB search
MLRSIPRRVPRRLPIFTTTATAGGPSRLAQRAFTCGYLRMSPSSLPPVQPPVSSTLPSDS
YQLLSTADKAGDAEDALYEQQIKDVEAWWNSPRFEGIKRPYSAADVVSKRGSLQQTYPSS
LMARKLFNLLNERAAENKPVHTMGAIDPVQMTQQAPNQEVLYVSGWACSSVLTTTNEVSP
DFGDYPYNTVPNQVQRLFKAQQLHDRKHWDARRKMTPEQRKSTPYIDYMRPIIADGDTGH
GGLTAVLKLAKLFAENGAAAVHFEDQMHGGKKCGHLAGKVLVPIGEHINRLVATRFQWDM
MGVENLVIARTDSESGKLLSSAIDVRDHEFILGVTEESEPLAETLQAMEREGAAPSEIDA
FELDWVKRHKLVTFDEAVDAHLEAEGAPQAARDAYKKRVKENPDLSITRRRELANDYTKT
PVVWSCDIPRTREGFYHYRAGFPAATKRAKEFGPYADLLWVETGDPNVEKAAKLAGEVRA
ALPGKKLVYNLSPSFNWMGQGFDEASLKSFIWDLAQHGFVLQLISLAGLHSGATITAELS
RAFKDEGMLAYVRLIQAREKELGVDVLTHQKWSGAPYMDGIVGAIQSGSSSSKSMGEGNT
EKDSEWGTEIHER
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctacgatcaattcctcgtcgagtaccccgacgtcttcccatcttcactacgacagcg
accgctggcggtccctctcgtctcgcccagcgcgcgttcacgtgcggctatttacggatg
tcgccgtcatcgctccctcccgtccagccccccgtttcctcaacgcttcccagcgattcc
taccagcttttatcgaccgccgacaaagctggagatgcagaggatgctctttacgaacaa
cagatcaaagatgttgaagcgtggtggaattccccccgctttgagggcatcaagcggccc
tactcggctgccgatgtcgttagcaagcggggatcgttgcagcagacgtacccgagctcg
ttgatggcgcggaagctgtttaatctgttgaacgagagagcggcagagaataagccagtt
catacgatgggcgccattgaccccgtacagatgacccagcaggctcctaaccaggaggtc
ctgtatgtatcgggctgggcgtgctcgtcggttttgacgacgaccaacgaggtgtctccc
gactttggtgattacccgtacaataccgtgcccaaccaggtccagagactgttcaaggct
cagcagttgcatgaccgcaaacactgggatgcgcggcggaagatgacccctgagcagcga
aagtctactccttacattgactatatgcgaccgattattgcagacggtgacaccggacac
ggtggcttgaccgcagtcctgaagctggccaagcttttcgctgagaacggtgccgcagct
gttcactttgaggaccagatgcacggcggaaagaagtgcggccatctggcgggtaaagtc
ttggttccgatcggagagcacatcaaccgccttgttgcgacgcgattccagtgggatatg
atgggtgttgagaaccttgttattgctcggactgactccgagagtggcaagctccttagc
agcgccattgatgtgcgagaccacgaattcattctcggagtcaccgaagagtcggaacct
ctcgcagagaccctgcaagccatggagagggagggagccgctccttcggagattgatgcc
tttgaactggactgggttaaaaggcacaagctagtgacatttgatgaggctgtcgatgcg
cacctggaggccgaaggtgctcctcaagccgctcgtgacgcatacaaaaagcgtgtcaag
gagaatccagacctgtccatcacccgtcgacgggagttggccaacgactacaccaagacc
ccggttgtttggtcctgcgacatcccccgcactagggaaggtttctatcactatcgagcc
ggtttcccagctgcaaccaaacgcgcaaaggagtttggcccttacgctgacctcctctgg
gtcgaaactggtgaccccaacgttgaaaaagctgcgaagctcgcaggcgaagtacgggct
gccctacctggcaagaaactcgtctacaacctcagcccttcattcaactggatgggtcaa
ggctttgatgaggcatctcttaagtccttcatctgggaccttgcacagcatggcttcgtc
ctccaattgatctccctcgccggtctccacagcggtgctactatcacagctgagctctcc
cgcgctttcaaggacgagggcatgcttgcctacgtccgactgattcaggctcgcgaaaaa
gaactcggcgttgatgtcctcactcaccagaaatggagcggtgcgccgtacatggatggt
attgtgggtgcgatccagagcggtagcagtagcagcaagagtatgggagaggggaatact
gagaaggactcggaatggggaacagagatccatgagagatga

DBGET integrated database retrieval system