KEGG   Aspergillus nidulans: AN8827.2Help
Entry
AN8827.2          CDS       T01016                                 

Definition
similar to AF156028_1 calcium/calmodulin dependent protein kinase C
Orthology
K07359  
calcium/calmodulin-dependent protein kinase kinase [EC:2.7.11.17]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     AN8827.2
Protein kinases [BR:ani01001]
 Serine/threonine protein kinases: Other group
  CAMKK family
   AN8827.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 507 aa AA seqDB search
MANEGAGSLQQDASPGSSARPEPYPRPRCLLGILHFSSTPSFESPQRHHRRNPIARRPVK
ETLNARSEYTLSQDDGTAEHRINQYVIKQEIGRGSFGAVHVAVDQYGNEYAVKEFSKARL
RKRAKSQLLRQSRGPKRPADGLNSPFHRQGPGLGDEEMKNALYFIKEEIAIMKKLHHNNL
VSLIEVLDDPTQDSLYMVMEMCKKGVVMKVTLEERADPYDDERCRCWFRDLILGIEYLHA
QGIVHRDIKPDNCLITNDDVLKVVDFGVSEMFEKNSDMFTAKSAGSPSFLPPELCVVKHG
DVSGKAADIWSMGVTLYCLRYGKLPFEEHSIIELYDAIKNRPIVCDGETDEVFKDLMLRI
LEKDPAKRIQMDELREHPWVTKNGMDPLLPKSENTAEIVDLPTEEEMNSAITKNFGHVLA
VMKAAKKFKSLLGPTRASTPIQSILGQEYETHFVEPPTQMDPEESVSLPSPLPYKKTQSL
NTYNRRAWERDDVTNKERFRLNTKCQN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgagggtgctggctctctgcaacaggatgccagtccaggttcttctgctcgg
ccagagccttatcctcgcccaagatgcttactcggcatcctgcatttcagctccacacct
tcgtttgagagccctcagagacatcatcgccgtaatccaatagcccggcgtcctgtgaag
gaaactctcaatgctcggtcagaatatactctcagccaagatgatggcactgcggagcat
agaatcaaccaatatgtgattaagcaggagattggccgcggctcgtttggtgcggtgcat
gttgctgttgaccagtatggaaatgaatatgctgtcaaagagttttccaaggcgcgtcta
agaaaacgcgcaaaatcgcaacttctgagacagtctcgaggtccaaaacgtccagcagat
ggcctaaactccccttttcatcgccagggaccgggacttggagacgaagagatgaaaaat
gctctctattttatcaaagaagaaattgccattatgaagaagttacaccacaacaatcta
gtatccttgatagaggtactggacgacccgacccaagattctctatatatggtcatggag
atgtgcaagaagggcgtggtcatgaaggtcactctcgaagagagggcggatccctacgat
gacgagcgttgtcgctgctggtttcgtgacctcattttgggcattgagtatttacatgcc
cagggtatcgtccaccgtgatatcaagcccgacaactgcctgataacgaacgatgatgtt
ctcaaagttgtcgattttggcgtatcagaaatgttcgaaaagaattcggacatgtttacg
gccaaatctgctggatctccttcctttctgccaccggaactctgcgttgttaagcacggc
gatgtatctggaaaggcggcggatatatggtccatgggcgtgaccttgtattgtttgcgc
tacggcaagcttcctttcgaggagcacagcattatcgaactctacgatgccataaaaaac
cgcccgattgtttgcgacggcgaaactgacgaagtttttaaagatttgatgttgcgaatt
ttggaaaaagaccctgcgaaaagaatacagatggacgagctgagggagcatccctgggtg
acgaagaatggcatggatcctttactgccaaagagtgagaatacggcagaaatagtcgac
cttcctacagaagaggaaatgaactccgcaatcacaaaaaattttggccatgtcttagcc
gtgatgaaagctgcgaagaaatttaaaagccttcttggcccgactcgagcttctacaccc
atacaaagtatcctcggccaagaatacgagacgcactttgtggaacctcctacgcaaatg
gatcctgaggagagcgtatccttgcctagtcctttaccatacaaaaaaacccaaagtttg
aacacttataaccggagagcttgggagcgtgacgatgttaccaacaaggaaagattccgg
ctcaatacgaagtgtcaaaattag

DBGET integrated database retrieval system