KEGG   Aspergillus nidulans: AN8920.2Help
Entry
AN8920.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ani  Aspergillus nidulans
Pathway
ani00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AN8920.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AN8920.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 Cyt-b5 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 2868237
NCBI-ProteinID: XP_682189
UniProt: A0A1U8QWQ0 Q5AS10
Position
VII
AA seq 458 aa AA seqDB search
MPSYTLEQVKAHCTPDDIWIILHNKVYEVTKYLEDHPGGSAVLIEVAGADATEAFEEIGH
SDEAREQLEPYYIGDLPDQEQAESVEIYRPTFEQVSQSAVINTKKTSKSFSSLLSVLVKL
GLTGAVGAATIAVFQKNWTPRQLLHALPALTTPIPLPRISGSGGSQFWSGVGIATITQLS
LSFGLGVWVSTKLDVQQEFTHYPPRRPASSARLIRLPSTTRALAPRSPVLDPRQWRSFPL
TSKKEVAPNVYRLVFALPKADDILGLPTGQHVALRATVDGKTVQRSYTPISNNTDRGHIE
LLIKVYPKGLLTNHLAQMEVGETIEMRGPKGAMKYSAQYAYRIGMIAGGTGITPMYQLIR
AICEDESDNTQVSLLYANNGEADILLREELESFAGRFPHKFKMEGFVNGEMIAKHIGSPA
DDAKVLLCGPPPMVEAMKKTLAGMGWDMPGAIANGTDQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctacacgcttgaacaggtcaaggcccactgcacaccggatgatatctggata
atcctgcacaacaaggtctacgaggtgaccaagtatctcgaagaccaccctggtggaagc
gccgtccttattgaagttgccggggctgatgccacggaagcttttgaggagatcggccac
tctgatgaggcgcgcgagcagctcgagccgtattatattggtgatttgccagatcaggaa
caagccgagtccgtcgagatctatcgaccgaccttcgagcaagtctcacagtctgccgtc
atcaacaccaagaagacgagcaagtccttctcgtcgcttcttagtgtgctagtcaagctc
ggccttacaggtgcagtaggtgctgccacaattgcggtctttcagaaaaactggacgccc
cgtcagctattgcatgctctccctgcgctgaccactccaatcccgctccctcggatatca
ggcagcgggggatcccagttctggtctggtgttgggattgccaccatcacgcagctgtct
ctatcctttggtctgggcgtctgggtgtcgaccaagctcgacgtgcagcaagagtttacg
cactacccacctcgacgaccagcgtcaagcgcacggctcatccgcctcccttccactaca
cgtgcgctggcaccgcgcagcccggtccttgatccgcgccaatggcgcagcttccctctc
actagcaagaaagaagtcgccccaaacgtgtacaggcttgtatttgccctccccaaggcg
gacgacatcctcggactcccaacagggcagcatgttgccctccgcgcaaccgtcgatgga
aagaccgtccagcgcagttacacgcccatctcgaacaacaccgaccgcggccacattgag
cttctgataaaggtttacccaaagggcctcttgaccaaccacctagcgcagatggaggtc
ggagagacgatcgaaatgcgcgggcccaagggcgccatgaagtactctgctcaatacgcc
taccggatcggcatgattgccggcggaacaggaatcacacccatgtaccagcttatccgg
gcaatctgcgaagatgagtccgacaatacacaagtcagtctgctgtacgccaacaacggc
gaggctgatattctcctccgtgaggagctggaaagctttgcggggcgtttcccacacaag
ttcaagatggaagggttcgtgaatggggaaatgatcgcgaagcatattgggtcgccggcg
gatgatgcaaaggtattgctctgtggaccaccgccaatggtcgaggctatgaagaagacg
ctggccggcatgggctgggacatgccaggggcaattgcaaacgggacagatcaatga

DBGET integrated database retrieval system