KEGG   Aspergillus nidulans: AN9148.2Help
Entry
AN9148.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ani  Aspergillus nidulans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ani00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ani00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ani00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ani00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 566 aa AA seqDB search
MATKDLPTHLSSNTGFGKHHGKTQSHMVSSVLCLCVDSFSGFRGAWKAPPAMTDASGYAI
CSQDVMSQTALQLCSLGTQAFENASTSVAASQMRNALNALAETVPDPNERKRFEAEMDNF
FALFRRFLNDKAKGNVVNWDRIAPPQPSQVVNYDDIGKESSVEFLNKLAVVKLNGGLGTS
MGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPFVLMNSFNTDQDTQSIIKKYQG
HNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFESLYNSGTLDKLLERG
VEYIFLSNADNLGAVVDTRILQHMIDTKAEYIMELTDKTKADVKGGTIIDYEGKVRLLEI
AQVPKEHVNEFKSIKKFKYFNTNNIWMNLRAIKRVVEENELEMEIIANEKSIPADKKGEA
DQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYRLEHGQLVMDPN
RFGGVPVIKLGSDFKKVSDFQKRIPSIPRIVELDHLTITGAVNLGRNVTLKGTVIIVATE
GSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaagatctgcctactcatctgtcctcaaacacggggttcggcaagcaccat
ggcaagactcaatctcatatggtaagttctgttctctgtctttgcgtcgactctttctct
ggttttcgtggcgcttggaaggcgcctcccgctatgactgacgcttctggctacgctatc
tgttcgcaggacgtaatgtcgcaaactgcgcttcaattgtgctctctcggtacacaggca
ttcgaaaatgcttccaccagtgttgccgcctcccagatgcgtaatgccctgaacgctctc
gctgagactgtccccgatcctaacgagcgcaaacgattcgaggccgagatggacaacttc
tttgctcttttccgcagattccttaatgataaggccaagggtaacgtcgtcaattgggac
cgtatcgcccctccccagccctcacaggtcgtcaactatgacgacattggcaaggaatcg
tctgtcgagttccttaacaagctcgctgtcgtcaagctcaacggtggtctcggtacctcc
atgggttgcgtcggtcccaagtccgtcatcgaggtccgtgagggcatgtccttcctggat
ctgtccgtccgtcagatcgagcacttgaaccgcacttacaatgtcaacgtcccctttgtc
ttgatgaactcgttcaacaccgaccaggacacacaatccatcatcaagaagtaccagggc
cacaacgtcgacatcattaccttcaaccagtctcggtaccccagaatcatcaaggactcg
cttctgcctgcgcccaagtccttcgatgctcctctgcaggactggtacccccctggtcac
ggtgacgtctttgaatcactgtacaactccggcaccctcgacaagctcttggagcgcggc
gtcgaatatattttcctgtccaacgccgacaacctgggcgctgttgttgatacccgcatc
ctgcagcacatgatcgacaccaaggctgaatatatcatggaattgaccgacaagaccaag
gccgatgtcaagggtggtactatcatcgactatgagggcaaggtccgtctccttgaaatc
gcccaggtgcccaaggagcacgtcaacgagttcaagtccatcaagaagttcaagtacttc
aacactaataacatctggatgaaccttcgcgccattaagcgtgttgtcgaggagaacgag
ctcgaaatggagattattgccaacgagaagtccatccctgcagacaagaagggtgaggcc
gaccaggccatctaccagcttgagactgctgttggtgccgccatccgtcacttcaagaac
gcccacggtgtcaacgttccccgtcgccgcttccttcccgtcaagacttgctccgacttg
ctgctggtcaagtccgacctctaccgcctcgagcacggtcagctcgtcatggaccctaac
cgatttggcggtgtccccgtcatcaagctcggctcagacttcaagaaggtttctgacttc
cagaagcgcattcccagcattccccgtatcgtggagctggaccatctcaccatcactgga
gccgtcaatctgggccgcaacgtgaccctgaaaggtacggtaatcattgtagctacagaa
ggcagcacgatcgacattcccccaggttctgtactggaaaactgtgttgtacagggcagt
cttcgcattctcgagcattaa

DBGET integrated database retrieval system