KEGG   Aspergillus nidulans: AN9148.2Help
Entry
AN9148.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ani  Aspergillus nidulans
Pathway
ani00040  Pentose and glucuronate interconversions
ani00052  Galactose metabolism
ani00500  Starch and sucrose metabolism
ani00520  Amino sugar and nucleotide sugar metabolism
ani01100  Metabolic pathways
ani01130  Biosynthesis of antibiotics
Module
ani_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AN9148.2
   00052 Galactose metabolism
    AN9148.2
   00500 Starch and sucrose metabolism
    AN9148.2
   00520 Amino sugar and nucleotide sugar metabolism
    AN9148.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AN9148.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP PilO
Motif
Other DBs
NCBI-GeneID: 2867998
NCBI-ProteinID: XP_682417
UniProt: Q5ARD2
Position
IV
AA seq 566 aa AA seqDB search
MATKDLPTHLSSNTGFGKHHGKTQSHMVSSVLCLCVDSFSGFRGAWKAPPAMTDASGYAI
CSQDVMSQTALQLCSLGTQAFENASTSVAASQMRNALNALAETVPDPNERKRFEAEMDNF
FALFRRFLNDKAKGNVVNWDRIAPPQPSQVVNYDDIGKESSVEFLNKLAVVKLNGGLGTS
MGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPFVLMNSFNTDQDTQSIIKKYQG
HNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFESLYNSGTLDKLLERG
VEYIFLSNADNLGAVVDTRILQHMIDTKAEYIMELTDKTKADVKGGTIIDYEGKVRLLEI
AQVPKEHVNEFKSIKKFKYFNTNNIWMNLRAIKRVVEENELEMEIIANEKSIPADKKGEA
DQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYRLEHGQLVMDPN
RFGGVPVIKLGSDFKKVSDFQKRIPSIPRIVELDHLTITGAVNLGRNVTLKGTVIIVATE
GSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaagatctgcctactcatctgtcctcaaacacggggttcggcaagcaccat
ggcaagactcaatctcatatggtaagttctgttctctgtctttgcgtcgactctttctct
ggttttcgtggcgcttggaaggcgcctcccgctatgactgacgcttctggctacgctatc
tgttcgcaggacgtaatgtcgcaaactgcgcttcaattgtgctctctcggtacacaggca
ttcgaaaatgcttccaccagtgttgccgcctcccagatgcgtaatgccctgaacgctctc
gctgagactgtccccgatcctaacgagcgcaaacgattcgaggccgagatggacaacttc
tttgctcttttccgcagattccttaatgataaggccaagggtaacgtcgtcaattgggac
cgtatcgcccctccccagccctcacaggtcgtcaactatgacgacattggcaaggaatcg
tctgtcgagttccttaacaagctcgctgtcgtcaagctcaacggtggtctcggtacctcc
atgggttgcgtcggtcccaagtccgtcatcgaggtccgtgagggcatgtccttcctggat
ctgtccgtccgtcagatcgagcacttgaaccgcacttacaatgtcaacgtcccctttgtc
ttgatgaactcgttcaacaccgaccaggacacacaatccatcatcaagaagtaccagggc
cacaacgtcgacatcattaccttcaaccagtctcggtaccccagaatcatcaaggactcg
cttctgcctgcgcccaagtccttcgatgctcctctgcaggactggtacccccctggtcac
ggtgacgtctttgaatcactgtacaactccggcaccctcgacaagctcttggagcgcggc
gtcgaatatattttcctgtccaacgccgacaacctgggcgctgttgttgatacccgcatc
ctgcagcacatgatcgacaccaaggctgaatatatcatggaattgaccgacaagaccaag
gccgatgtcaagggtggtactatcatcgactatgagggcaaggtccgtctccttgaaatc
gcccaggtgcccaaggagcacgtcaacgagttcaagtccatcaagaagttcaagtacttc
aacactaataacatctggatgaaccttcgcgccattaagcgtgttgtcgaggagaacgag
ctcgaaatggagattattgccaacgagaagtccatccctgcagacaagaagggtgaggcc
gaccaggccatctaccagcttgagactgctgttggtgccgccatccgtcacttcaagaac
gcccacggtgtcaacgttccccgtcgccgcttccttcccgtcaagacttgctccgacttg
ctgctggtcaagtccgacctctaccgcctcgagcacggtcagctcgtcatggaccctaac
cgatttggcggtgtccccgtcatcaagctcggctcagacttcaagaaggtttctgacttc
cagaagcgcattcccagcattccccgtatcgtggagctggaccatctcaccatcactgga
gccgtcaatctgggccgcaacgtgaccctgaaaggtacggtaatcattgtagctacagaa
ggcagcacgatcgacattcccccaggttctgtactggaaaactgtgttgtacagggcagt
cttcgcattctcgagcattaa

DBGET integrated database retrieval system