KEGG   Aspergillus nidulans: AN9203.2Help
Entry
AN9203.2          CDS       T01016                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     AN9203.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 593 aa AA seqDB search
MRHTRNTIFAMATVGAASAKSMGDVCTVSHVRSILPTNGTLLGIDLLPSLTTASVYNASS
ASSSSASAGGMAMGGSSSSYDYCNVTVAYTHTGKNDKVVVKYAFPSPSEFKNRFYVAGGG
GYSLSSDATGGLQYGAVSGATDAGYDAFDYSFDEVVLYGNGSINWDATYMFSYQALGEMT
KLGKALTRGFYGKSSDAKVYTYYEGCSDGGREGMSQVQRYGDEYDGAITGAPAFRHSQQQ
VNHLFPAEVEYTLDYYPPPCELAKIVNATIEACDPLDGRTDGVISRTDLCMLNFDLSSVI
GESYYCAEQNYTSLGFGFSKRADGSTTSYQPAQNGTVSKEGVAVAQAIYNGLHSTSGERA
YLSWQIGSELSDADTTYNSDTGKWELTIQSTGGVFVAKMVELLQLDNLESLENTTYDTLI
QWMETGMVRYLDSLQTTLPDLTTFQSSGGKLLHYHGESDPSVPAASSVHYWQAVRSIMYS
DVSYKKSLEEMQDWYQFYLIPGAAHCGSNSLQPGPYPENNMEIMIDWVENGVKPSRLNAT
VSSGTYEGETQMLCQWPKRPLWKDNSDDFECVSDAKSIETWTYSFPAFKVPVY
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatacgcgcaacaccatcttcgcgatggccactgtcggtgccgccagcgcaaag
tctatgggtgacgtctgtaccgtctcgcacgtccgatccatcctcccgacgaatggcacc
ctcctcggtatcgacttgcttccctccctgaccaccgccagcgtgtacaatgccagttcg
gcttcaagctcctcggcctcggctggaggcatggcaatgggcggctcttcgtcttcctac
gactattgtaacgtgacggttgcgtacactcacaccggcaagaacgacaaggtggttgtc
aagtatgccttccctagtcccagcgagttcaaaaaccggttctacgtcgcaggtggtggc
ggttactcgctgtctagcgatgctaccggcggacttcagtacggtgccgtgtccggcgct
accgatgctgggtacgacgcatttgactactcgttcgacgaagttgttctctacggcaat
gggagcatcaactgggacgctacatacatgttctcataccaggctcttggcgaaatgacc
aagcttggaaaagccctgactcgcggtttctacggcaagtcgtccgacgctaaggtgtac
acttactacgagggatgctccgacggtggccgtgagggtatgagccaagttcagcggtac
ggagacgaatatgatggtgctatcaccggtgccccggctttccgtcactcgcagcagcaa
gtcaaccatcttttcccagcggaggttgagtatacccttgactactacccacccccctgt
gagctcgccaagattgtcaacgcgaccatcgaggcttgtgacccgcttgatggacgtact
gacggtgtaatctcccgtacggatctctgcatgctgaacttcgacctttcctctgttatc
ggagagtcgtattactgcgctgagcagaactacacctccctcggcttcggcttcagcaag
cgcgccgatggaagcacaaccagctaccagcctgcccagaatggcactgttagtaaggag
ggtgtcgctgttgcgcaggctatctataacggtttgcacagcaccagcggcgaacgtgct
tacctctcctggcagattggttctgagctctctgacgctgataccacctacaactctgac
accggaaagtgggagcttactattcagtcaactggaggcgtcttcgtggccaagatggtg
gagcttcttcaattggacaacctcgagagcctggaaaacaccacctacgacactctgatc
cagtggatggagaccggtatggtccggtacttggactccctgcagaccactctccccgac
cttaccaccttccagagcagcgggggtaagcttcttcactaccacggcgaatccgacccc
tcagtccccgctgcgagctcggtccactactggcaggcggtgcgcagtatcatgtactca
gacgtttcatacaagaagagccttgaggaaatgcaggactggtaccagttttatcttatc
cccggtgctgcccactgcggttcaaactccttgcagcccggcccctacccagagaataac
atggaaatcatgatcgactgggtcgagaatggtgtcaagccatctcgtctcaatgccacg
gtcagctccggtacctatgaaggtgagactcagatgctctgccagtggcccaagcgcccc
ctgtggaaggataacagcgacgacttcgagtgtgtgagcgatgcgaagtcgatcgagact
tggacctactctttcccagccttcaaggtgcctgtttactaa

DBGET integrated database retrieval system