KEGG   Aspergillus nidulans: AN9388.2Help
Entry
AN9388.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00350  Tyrosine metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AN9388.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AN9388.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-GeneID: 2867777
NCBI-ProteinID: XP_682657
UniProt: A0A1U8QPW8 Q5AQP2
Position
VIII
AA seq 340 aa AA seqDB search
MRLAGVLFSLALLHLASGVPHGSRTTCSNPPVRKEWRQLSAEEKAEYIAAVQCLTTLDPK
SGLDGTANRFDDFQAVHSNQTPSIHWVGHFALWHRYFVASYEKSLREECGYTGAQPYWNW
SLDASTNLSSTAIFETEIFDPDTGFGGNGAWVEITDPADNPFNLTGRTGGGCVKTGPFTP
DKFQLHHSGGGCLKRDFIPWIMNSFAAQSLVDWVQSQPDYTSFARALENIPDFSEPNIHG
SGHFGAGGVLGTLGNQYESPGDPLFYLHHGNLDRILWEWQQQDLPTRLHQVGGPIEPLDY
SGKNVTLDFTVNIGALAGNATLEQLLSTNGDVLCYTYDTA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcgccggggtcctcttctctttggcgcttcttcaccttgcctccggtgttccc
catgggagccgtacaacgtgcagtaatccccctgtgcgcaaagaatggagacaactgagt
gccgaagagaaggcagagtacattgcggccgtccaatgcttgactactctggatcccaag
tctggtctcgatggtaccgccaatcgttttgatgatttccaagctgttcactcaaatcaa
accccaagtattcactgggtgggccactttgccctctggcatcgatactttgtcgcttct
tacgagaagtcactgcgtgaggaatgtggatataccggtgcccagccgtactggaattgg
tcgcttgatgcctcgactaacctctcctcaaccgctatcttcgagacggagatctttgat
ccagataccggattcggcggaaatggagcgtgggttgagatcaccgatccagcagacaac
cccttcaacctcactggccgtaccggcggtggctgcgtcaagactggccccttcacgcca
gacaagttccagcttcaccacagtggcggcggctgcctcaagcgcgacttcatcccctgg
atcatgaacagcttcgcagcacagagcctcgtcgactgggtgcagagccagcccgactac
acatccttcgcacgagccctggagaacatccctgacttcagtgagcccaacattcacggc
agcggtcactttggtgctggcggtgtcctcggaaccctaggtaaccagtacgagagcccc
ggtgacccactcttctacctacaccacggcaacctggaccgcattctctgggagtggcag
cagcaggatcttcccacacgtcttcaccaggtcggtggtcctattgaaccacttgactac
agtgggaagaacgtcactcttgactttacagtcaacattggcgctcttgctggaaatgct
acccttgagcagcttctcagcacaaatggtgatgttctgtgctatacctacgacaccgct
tga

DBGET integrated database retrieval system