KEGG   Aspergillus nidulans: AN9470.2Help
Entry
AN9470.2          CDS       T01016                                 

Definition
URIC_EMENI Uricase (Urate oxidase)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ani  Aspergillus nidulans
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ani00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:ani00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 301 aa AA seqDB search
MSTVAAARYGKDNVRVYKVHKDPKTGVQTVTEMTVCVLLEGEIDTSYTKADNSVIVATDS
IKNTIFILAKQNPVTPPELFGSILGTHFINKYKHIHVAHTNIITHRWTRLNIDGKPHSHS
FVRDSEETRNVQVDVTEGVGIDIKSSINKLTVLKSTGSQFWGFVRDEYTTLPEVWDRILS
TDVEATWAWKRFSGLDEVRGNVPKFDETWEAARNITLKTFAEEESASVQATMYKMGEQIL
AYQPLLETVEYSLPNKHYFEIDLSWHKGLKNTGKDAEVFVPQTNPNGLIKCTVGRKSKAK
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttgcagctgcccgctatggtaaggacaatgttcgagtctacaaggtccac
aaggacccgaagactggagttcagaccgtcactgaaatgaccgtctgcgtcctcctggaa
ggtgaaatcgatacttcctacaccaaagccgacaacagcgtcatcgtcgcaacagactcc
atcaagaataccatctttattctggccaagcagaaccccgtcacgcctcccgagctcttt
ggctccattcttggtacccatttcatcaacaagtacaagcacatccacgtcgcgcatacc
aacatcatcacgcaccgctggacccgccttaacatcgacggcaaaccacactcacactcc
tttgtccgcgacagcgaggaaacccgcaacgtgcaagtcgacgtgaccgagggcgtcggc
attgatatcaagtcctcaatcaacaagctcaccgtgctcaagagcacgggttcgcaattc
tggggcttcgtccgcgacgagtacacaacactccccgaagtatgggaccgcatccttagt
accgatgttgaagcgacgtgggcatggaaaaggttctctgggctggatgaggtccgtggg
aatgtgcccaagttcgatgagacttgggaggcggcgcggaacattacgctcaagacattt
gccgaggaggagagtgctagtgtccaggcgactatgtacaagatgggcgagcagattcta
gcgtaccagccgcttcttgagactgtcgagtactcgttgccgaataaacattactttgag
attgatctgagctggcacaagggccttaagaacacgggcaaggatgctgaggtgtttgtt
ccccagacaaaccctaacggactgatcaagtgcactgtcggccggaagtccaaggctaag
ctatag

DBGET integrated database retrieval system