KEGG   Aspergillus nidulans: AN9470.2Help
Entry
AN9470.2          CDS       T01016                                 

Definition
URIC_EMENI Uricase (Urate oxidase)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ani  Aspergillus nidulans
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AN9470.2
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AN9470.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AN9470.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 301 aa AA seqDB search
MSTVAAARYGKDNVRVYKVHKDPKTGVQTVTEMTVCVLLEGEIDTSYTKADNSVIVATDS
IKNTIFILAKQNPVTPPELFGSILGTHFINKYKHIHVAHTNIITHRWTRLNIDGKPHSHS
FVRDSEETRNVQVDVTEGVGIDIKSSINKLTVLKSTGSQFWGFVRDEYTTLPEVWDRILS
TDVEATWAWKRFSGLDEVRGNVPKFDETWEAARNITLKTFAEEESASVQATMYKMGEQIL
AYQPLLETVEYSLPNKHYFEIDLSWHKGLKNTGKDAEVFVPQTNPNGLIKCTVGRKSKAK
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttgcagctgcccgctatggtaaggacaatgttcgagtctacaaggtccac
aaggacccgaagactggagttcagaccgtcactgaaatgaccgtctgcgtcctcctggaa
ggtgaaatcgatacttcctacaccaaagccgacaacagcgtcatcgtcgcaacagactcc
atcaagaataccatctttattctggccaagcagaaccccgtcacgcctcccgagctcttt
ggctccattcttggtacccatttcatcaacaagtacaagcacatccacgtcgcgcatacc
aacatcatcacgcaccgctggacccgccttaacatcgacggcaaaccacactcacactcc
tttgtccgcgacagcgaggaaacccgcaacgtgcaagtcgacgtgaccgagggcgtcggc
attgatatcaagtcctcaatcaacaagctcaccgtgctcaagagcacgggttcgcaattc
tggggcttcgtccgcgacgagtacacaacactccccgaagtatgggaccgcatccttagt
accgatgttgaagcgacgtgggcatggaaaaggttctctgggctggatgaggtccgtggg
aatgtgcccaagttcgatgagacttgggaggcggcgcggaacattacgctcaagacattt
gccgaggaggagagtgctagtgtccaggcgactatgtacaagatgggcgagcagattcta
gcgtaccagccgcttcttgagactgtcgagtactcgttgccgaataaacattactttgag
attgatctgagctggcacaagggccttaagaacacgggcaaggatgctgaggtgtttgtt
ccccagacaaaccctaacggactgatcaagtgcactgtcggccggaagtccaaggctaag
ctatag

DBGET integrated database retrieval system