KEGG   Anaeromyxobacter sp. K: AnaeK_0168Help
Entry
AnaeK_0168        CDS       T00748                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00010  Glycolysis / Gluconeogenesis
ank00052  Galactose metabolism
ank00500  Starch and sucrose metabolism
ank00520  Amino sugar and nucleotide sugar metabolism
ank00521  Streptomycin biosynthesis
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
Module
ank_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_0168
   00052 Galactose metabolism
    AnaeK_0168
   00500 Starch and sucrose metabolism
    AnaeK_0168
   00520 Amino sugar and nucleotide sugar metabolism
    AnaeK_0168
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AnaeK_0168
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AnaeK_0168
Enzymes [BR:ank01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AnaeK_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACG71411
UniProt: B4ULG4
Position
188841..189803
Genome map
AA seq 320 aa AA seqDB search
MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLRERGPEAVVATVLHALGQAAGAAGI
APASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGTLLEKALGVPVRVANDLSVAAWG
EKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGELGHIKVRLPRPGFTPRRC
GCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELVEGDLARVTASVVEEAHALGDAYA
VALWDEVAELLGLSVANLVTLLNPARLILGGGVLLGAPRLADLTLRRFDEAVSRSATRGL
TVERAWLGDDAGVIGAAVLE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggctcgcgctgggcgtggacctggggggcaccaacgcgcgcgcggcggtggtg
gaccgcgccaccggcgagatcgtggcctcgcacaaggagccgctgcgcgagcgcgggccc
gaggcggtggtcgcgaccgtcctccacgcgctcgggcaggcggccggcgcggccgggatc
gcgccggcgtcggccggccgggtcggggtgggcgtggccgggcaggtgctcggcgccacc
ggcgtggtgatgaacgcgcccaacctgggctggcgcgacgtggcgttcggcacgctgctg
gagaaggcgctcggcgtgccggtgcgggtcgcgaacgacctgtcggtggcggcctggggc
gagaagcgcttcggcgccgcccgcggcatcgaggacgtggtgctggtgttcgtcggctcc
ggcgtgggctccggcctcatcctcggcggccggctgcacgacggcgcccagggggtggcc
ggcgagctcgggcacatcaaggtgcgcctgccgcgcccggggttcacgccgcgccgctgc
ggctgcggccagctcggctgcctcgaggcgtacacctcgggggtgaacgtggccgcgcgc
gtgcgcgaggagatcgcggccggcgccgccacccgcgtgctcgagctggtggagggcgac
ctcgcccgcgtcaccgccagcgtggtggaggaggcgcacgcgctgggcgacgcctacgcc
gtggcgctgtgggacgaggtcgcggagctgctcgggctctccgtggcgaacctggtcacg
ctgctcaaccccgcccggctcatcctggggggcggcgtgctgctgggcgcaccccgcctc
gccgacctgacgctccgccgcttcgacgaggcggtatcgcgctcggccacgcgcgggctc
accgtggagcgcgcctggctcggcgacgacgccggggtcatcggcgccgcggtgctcgag
tag

DBGET integrated database retrieval system