KEGG   Anaeromyxobacter sp. K: AnaeK_0168Help
Entry
AnaeK_0168        CDS       T00748                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AnaeK_0168
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_0168
   00052 Galactose metabolism
    AnaeK_0168
   00500 Starch and sucrose metabolism
    AnaeK_0168
   00520 Amino sugar and nucleotide sugar metabolism
    AnaeK_0168
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AnaeK_0168
   00524 Butirosin and neomycin biosynthesis
    AnaeK_0168
Enzymes [BR:ank01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AnaeK_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
188841..189803
Genome map
AA seq 320 aa AA seqDB search
MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLRERGPEAVVATVLHALGQAAGAAGI
APASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGTLLEKALGVPVRVANDLSVAAWG
EKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGELGHIKVRLPRPGFTPRRC
GCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELVEGDLARVTASVVEEAHALGDAYA
VALWDEVAELLGLSVANLVTLLNPARLILGGGVLLGAPRLADLTLRRFDEAVSRSATRGL
TVERAWLGDDAGVIGAAVLE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggctcgcgctgggcgtggacctggggggcaccaacgcgcgcgcggcggtggtg
gaccgcgccaccggcgagatcgtggcctcgcacaaggagccgctgcgcgagcgcgggccc
gaggcggtggtcgcgaccgtcctccacgcgctcgggcaggcggccggcgcggccgggatc
gcgccggcgtcggccggccgggtcggggtgggcgtggccgggcaggtgctcggcgccacc
ggcgtggtgatgaacgcgcccaacctgggctggcgcgacgtggcgttcggcacgctgctg
gagaaggcgctcggcgtgccggtgcgggtcgcgaacgacctgtcggtggcggcctggggc
gagaagcgcttcggcgccgcccgcggcatcgaggacgtggtgctggtgttcgtcggctcc
ggcgtgggctccggcctcatcctcggcggccggctgcacgacggcgcccagggggtggcc
ggcgagctcgggcacatcaaggtgcgcctgccgcgcccggggttcacgccgcgccgctgc
ggctgcggccagctcggctgcctcgaggcgtacacctcgggggtgaacgtggccgcgcgc
gtgcgcgaggagatcgcggccggcgccgccacccgcgtgctcgagctggtggagggcgac
ctcgcccgcgtcaccgccagcgtggtggaggaggcgcacgcgctgggcgacgcctacgcc
gtggcgctgtgggacgaggtcgcggagctgctcgggctctccgtggcgaacctggtcacg
ctgctcaaccccgcccggctcatcctggggggcggcgtgctgctgggcgcaccccgcctc
gccgacctgacgctccgccgcttcgacgaggcggtatcgcgctcggccacgcgcgggctc
accgtggagcgcgcctggctcggcgacgacgccggggtcatcggcgccgcggtgctcgag
tag

DBGET integrated database retrieval system