KEGG   Anaeromyxobacter sp. K: AnaeK_0224Help
Entry
AnaeK_0224        CDS       T00748                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00330  Arginine and proline metabolism
ank00332  Carbapenem biosynthesis
ank01100  Metabolic pathways
ank01130  Biosynthesis of antibiotics
ank01230  Biosynthesis of amino acids
Module
ank_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AnaeK_0224
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AnaeK_0224
Enzymes [BR:ank01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AnaeK_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACG71466
UniProt: B4UM58
Position
241675..242826
Genome map
AA seq 383 aa AA seqDB search
MPLPMSRSALRRVKRLVVKVGTGTLTDRAGRFDRDNCARLASELAEVARGRKVVLVSSGA
VALGAERLGLARSRGKPWDIPTKQACAAAGQPHLMAAWGEALGRHGLVTAQVLLTADDLA
SRKRFLNARRTFERLLDAGAVPVVNENDTVAVDEIKVGDNDTLAALVAGCVEADAVAMLT
DVDGLYDRNPAEPGARLLRDVPRVTAEIERSAGGAGSERSVGGMITKVKAARRLGAQGVV
TALLSGRRARALPALLAGEPVGTVFAPGVHRLSSRQGWLAAAARGKGVILVDAGARRALV
EQGRSLLPSGVRGVQGQFGVGDPVDVAVDPARPFARGLAGYGADEVRRIAGLKTGEIERA
LGYKYLDEIVHRNDLVVLETGRE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccccatgtcccgaagcgccctccgccgcgtgaagcggctcgtggtcaaggtc
ggcaccggcacgctcaccgaccgcgccggccggttcgatcgcgacaactgcgcgcggctc
gcctccgagctggccgaggtggcgcgcggccggaaggtggtgctcgtctcctccggcgcg
gtggcgctcggcgccgagcggctcggcctcgcgcgcagccgcggcaagccctgggacatc
cccaccaagcaggcctgcgccgccgccggccagccgcacctcatggccgcctggggcgag
gcgctgggccgccacgggctcgtcaccgcccaggtgctgctcaccgccgacgacctcgcc
agccgcaagcgcttcctcaacgcgcgccgcacgttcgagcggctgctcgacgcgggcgcg
gtgccggtggtgaacgagaacgacaccgtggcggtggacgagatcaaggtcggcgacaac
gacacgctcgccgcgctggtggcgggctgcgtggaggccgacgcggtcgcgatgctcacc
gacgtggacgggctctacgaccggaaccccgccgagcccggggcgcggctgctgcgcgac
gtgccgcgggtcaccgccgagatcgagcggagcgcgggcggggcggggagcgagcgcagc
gtgggcgggatgatcaccaaggtgaaggcggcgcggcggctcggcgcgcagggcgtcgtc
accgcgctcctgtccgggcggcgcgcgcgcgcgctcccggcgctgctcgccggcgagccg
gtcggcaccgtgttcgcgcccggggttcaccggctcagctcgcgccagggctggctcgcc
gcggccgcgcgcggcaagggcgtcatcctggtggacgcgggggcgcggcgcgcgctggtg
gagcaggggcggagcctcttgccgagcggcgtccggggggtgcagggccagttcggggtc
ggggacccggtggacgtcgcggtggacccggcccgccccttcgcgcggggcctggcgggc
tacggcgccgacgaggtccgccgcatcgccgggctgaagaccggcgagatcgagcgcgcg
ctcgggtataagtacctcgacgagatcgtccaccggaacgacctggtggtcctcgagacc
ggccgggagtga

DBGET integrated database retrieval system