KEGG   Anaeromyxobacter sp. K: AnaeK_0288Help
Entry
AnaeK_0288        CDS       T00748                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ank03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
326034..326876
Genome map
AA seq 280 aa AA seqDB search
MPELPEVEIAARNLRRWAEGRRVEEVGWDPRARRIFRPATPAAFARALEGARFAGIRRIG
KHLLVSLERGGAPVGLLAHLGMTGKWVLRGAEEPAPRHARAWLRLEGGGVLHFQDSRLFG
RLRTVPGARFEDVPEVAALGPDPLEHGIQPAALAGALAKSRLPVKVKLLDQRLLPGVGNI
HASEACFRARVDPRRPSRALSRAGAKALAAGILASFRMTLDAEDGPEITYVEEPGAENPF
LVYAREGEPCPRCRRAGRTSPILRVVQAQRSTFFCPRCQR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctccccgaggtcgagatcgcggcgcggaacctccgccgctgggcggagggc
cgccgcgtcgaggaggtcggctgggatccccgggcgcgccggatcttccgccccgcgacg
cccgccgcgttcgcccgcgcgctggagggcgcccggttcgccgggatccggcgcatcggc
aagcacctgctcgtctcgctcgagcgcggcggcgcgccggtcgggctgctcgcgcacctc
ggaatgaccggcaagtgggtgctccgcggcgccgaagagccggcgccgcgccacgcgcgg
gcctggctgcgcctggagggcggcggggtgctgcacttccaggactcgcgcctgttcggg
cggctgcggaccgtgcccggcgcgcgcttcgaggacgtgccggaggtcgcggcgctcggt
ccggatccgctggagcacggcatccagcccgccgcgctggccggcgcgctcgcgaagagc
cggctgccggtgaaggtcaagctcctcgaccagcggctcctgcccggggtcgggaacatc
cacgccagcgaggcctgcttccgggcgcgcgtcgatccgcgccggccgtcccgggcgctg
tcgcgcgccggggcgaaggcgctcgcggcgggcatcctggcctccttccgcatgacgctc
gacgcggaggacgggccggagatcacctacgtcgaggagcccggggcggagaacccgttc
ctcgtgtacgcgcgcgagggcgagccctgcccgcgctgccggagggccggccggacctcg
cccatcctgcgggtggtgcaggcgcagcgctccaccttcttctgcccccgctgccagcgg
tag

DBGET integrated database retrieval system