KEGG   Anaeromyxobacter sp. K: AnaeK_0436Help
Entry
AnaeK_0436        CDS       T00748                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00071  Fatty acid degradation
ank00280  Valine, leucine and isoleucine degradation
ank00281  Geraniol degradation
ank00310  Lysine degradation
ank00362  Benzoate degradation
ank00380  Tryptophan metabolism
ank00410  beta-Alanine metabolism
ank00640  Propanoate metabolism
ank00650  Butanoate metabolism
ank00903  Limonene and pinene degradation
ank00930  Caprolactam degradation
ank01040  Biosynthesis of unsaturated fatty acids
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
ank01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AnaeK_0436
   00650 Butanoate metabolism
    AnaeK_0436
  Lipid metabolism
   00071 Fatty acid degradation
    AnaeK_0436
   01040 Biosynthesis of unsaturated fatty acids
    AnaeK_0436
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AnaeK_0436
   00310 Lysine degradation
    AnaeK_0436
   00380 Tryptophan metabolism
    AnaeK_0436
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AnaeK_0436
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AnaeK_0436
   00281 Geraniol degradation
    AnaeK_0436
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AnaeK_0436
   00930 Caprolactam degradation
    AnaeK_0436
Enzymes [BR:ank01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AnaeK_0436
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AnaeK_0436
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AnaeK_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM
Motif
Other DBs
NCBI-ProteinID: ACG71678
UniProt: B4UB30
Position
493734..495911
Genome map
AA seq 725 aa AA seqDB search
MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAMREFAAHLDRLEKDEA
VKAVVVATGKPDVWVAGAKVELMQEAKDAAEAERLSRDGQALFDRVERCRKPVVAAIHGA
CLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQRLPRLIGIQPALDLILAG
KTVKARKALKLGLVDEAVPPPLLRQVAQERAAALASGKLRRAPRRDAGAVARVTRAALEE
NFLGREVLFRQARKLTLAKTKGHYPAPLRALEAIEHGYAKGFEKGLEKEAELFGKLAMTP
EAHRLMEIFFATTALKKDNGVDDPAVKARPVSAVGVLGGGLMGGGIAYVTVNAGLPVRLR
ERDDAAAAHGVAAVRGVLDERVKRRSIDRLERAEKLRLLTTTTDWSGLERVDVLVEAVFE
DLALKQEMVRAFEAVNPTGIFASNTSSIPIGRIAEASRHPETVLGMHYFSPVHKMPLLEV
IVTPRTAPEATATAVALGKKQGKTVIVVRDGPGFYTSRILAPYMNEAAHLLVEGAAIEDL
DHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAFGARMAPPPALHDVVKAGRLGRKNG
KGFYTYGGKEKRVDETVYDLLPGGRRRKRVAADEIQERLVLQLVNEAVRCLGEGILRSAR
DGDVGAVFGLGFPPFRGGPFRWADAVGTKALLDRMERLRARHGERFEPAPLLAELGRAGR
PFHGG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggctgaggcgatgacggcgggccagggcgcgtcgaggtacttccgcgtggag
gtcgccggcggcgtggcgacgctggtgctcgacgagccgggcgagcgcgtgaacaccgtg
caccccgaggcgatgcgggagttcgcggcccacctcgaccggctggagaaggacgaggcg
gtgaaggccgtcgtggtcgccaccggcaagcccgacgtgtgggtggccggcgcgaaggtc
gagctgatgcaggaggcgaaggacgccgccgaggcggagcggctgtcgcgcgacggccag
gcgctgttcgaccgggtggagcgctgccggaagccggtggtggccgccatccacggcgcc
tgcctgggcggcgggctggagtgggcgctcgcctgccactaccggatcgccaccgatcac
ccgaagacctcgctcggcctggtcgaggtgcagctcggcctcatcccgggcggcggcggg
acgcagcggctcccgcggctcatcggcatccagccggcgctcgacctcatcctggcgggc
aagaccgtgaaggcgcggaaggcactgaagctcggcctggtggacgaggcggtcccgccg
ccgctgctgcggcaggtggcgcaggagcgcgccgccgcgctcgcctcgggcaagctgcgc
cgcgccccgcgccgggacgccggggcggtggcccgggtcacccgcgccgccctggaggag
aacttcctcggccgcgaggtcctgttccggcaggcgcggaagctcacgctcgcgaagacg
aaggggcactacccggcgccgctgcgcgccctcgaggccatcgagcacgggtacgcgaag
ggcttcgagaaggggctggagaaggaggccgagctgttcgggaagctcgccatgacgccg
gaggcgcaccggctcatggagatcttcttcgccaccaccgcgctcaagaaggacaacggg
gtggacgatcccgccgtgaaggcgcgcccggtgtccgcggtgggcgtgctcggcggcggc
ctcatgggcggcgggatcgcctacgtgaccgtgaacgccggcctgccggtgcgcctgcgc
gagcgggacgacgccgcggcggcgcacggggtggcggcggtgcgcggcgtcctcgacgag
cgggtgaagcgccggtcgatcgaccggctggagcgcgccgagaagctgcgcctgctcacc
accaccaccgactggtccggcctggagcgggtggacgtgctcgtcgaggcggtgttcgag
gacctggcgctgaagcaggagatggtgcgcgcgttcgaggcggtgaacccgaccggcatc
ttcgcctccaacacctcctccatccccatcggccgcatcgccgaggcgtcccgccacccc
gagaccgtgctcgggatgcactacttctccccggtccacaagatgccgctgctcgaggtg
atcgtcacgccgcgcacggcgccggaggcgaccgccaccgcggtggcgctcgggaagaag
cagggcaagacggtgatcgtggtgcgcgacgggcccggcttctacacgagccgcatcctc
gcgccgtacatgaacgaggccgcgcacctgctggtcgagggcgcggcgatcgaggacctg
gaccacgcgctggtggcgttcgggttcccggtgggccccatcaccctgctcgacgaggtc
ggcatcgacgtcggcgacaaggtcgggaagatcctgcaggaggcgttcggcgcgcggatg
gcgccgccgccggcgctgcacgacgtggtgaaggcggggcgcctgggccgcaagaacggc
aagggcttctacacctacggcggcaaggagaagcgggtggacgagaccgtctacgacctg
ctgcccgggggccgccgccgcaagcgcgtcgccgcggacgagatccaggagcggctggtg
ctgcagctcgtgaacgaggcggtccgctgcctgggcgagggcatcctgcgctcggcgcgc
gacggcgacgtcggcgcggtgttcggcctcggcttcccgccgttccgcggcgggccgttc
cgctgggccgacgcggtgggcacgaaggcgctgctcgaccggatggagcggctgcgcgcg
cggcacggcgagcgcttcgagccggcgccgctgctcgccgagctgggccgggcgggccgg
ccgttccacggcggctag

DBGET integrated database retrieval system