KEGG   Anaeromyxobacter sp. K: AnaeK_0436Help
Entry
AnaeK_0436        CDS       T00748                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AnaeK_0436 (fadJ)
   01212 Fatty acid metabolism
    AnaeK_0436 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AnaeK_0436 (fadJ)
   00650 Butanoate metabolism
    AnaeK_0436 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    AnaeK_0436 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    AnaeK_0436 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AnaeK_0436 (fadJ)
   00310 Lysine degradation
    AnaeK_0436 (fadJ)
   00380 Tryptophan metabolism
    AnaeK_0436 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AnaeK_0436 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AnaeK_0436 (fadJ)
   00281 Geraniol degradation
    AnaeK_0436 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AnaeK_0436 (fadJ)
Enzymes [BR:ank01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AnaeK_0436 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AnaeK_0436 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AnaeK_0436 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
493734..495911
Genome map
AA seq 725 aa AA seqDB search
MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAMREFAAHLDRLEKDEA
VKAVVVATGKPDVWVAGAKVELMQEAKDAAEAERLSRDGQALFDRVERCRKPVVAAIHGA
CLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQRLPRLIGIQPALDLILAG
KTVKARKALKLGLVDEAVPPPLLRQVAQERAAALASGKLRRAPRRDAGAVARVTRAALEE
NFLGREVLFRQARKLTLAKTKGHYPAPLRALEAIEHGYAKGFEKGLEKEAELFGKLAMTP
EAHRLMEIFFATTALKKDNGVDDPAVKARPVSAVGVLGGGLMGGGIAYVTVNAGLPVRLR
ERDDAAAAHGVAAVRGVLDERVKRRSIDRLERAEKLRLLTTTTDWSGLERVDVLVEAVFE
DLALKQEMVRAFEAVNPTGIFASNTSSIPIGRIAEASRHPETVLGMHYFSPVHKMPLLEV
IVTPRTAPEATATAVALGKKQGKTVIVVRDGPGFYTSRILAPYMNEAAHLLVEGAAIEDL
DHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAFGARMAPPPALHDVVKAGRLGRKNG
KGFYTYGGKEKRVDETVYDLLPGGRRRKRVAADEIQERLVLQLVNEAVRCLGEGILRSAR
DGDVGAVFGLGFPPFRGGPFRWADAVGTKALLDRMERLRARHGERFEPAPLLAELGRAGR
PFHGG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggctgaggcgatgacggcgggccagggcgcgtcgaggtacttccgcgtggag
gtcgccggcggcgtggcgacgctggtgctcgacgagccgggcgagcgcgtgaacaccgtg
caccccgaggcgatgcgggagttcgcggcccacctcgaccggctggagaaggacgaggcg
gtgaaggccgtcgtggtcgccaccggcaagcccgacgtgtgggtggccggcgcgaaggtc
gagctgatgcaggaggcgaaggacgccgccgaggcggagcggctgtcgcgcgacggccag
gcgctgttcgaccgggtggagcgctgccggaagccggtggtggccgccatccacggcgcc
tgcctgggcggcgggctggagtgggcgctcgcctgccactaccggatcgccaccgatcac
ccgaagacctcgctcggcctggtcgaggtgcagctcggcctcatcccgggcggcggcggg
acgcagcggctcccgcggctcatcggcatccagccggcgctcgacctcatcctggcgggc
aagaccgtgaaggcgcggaaggcactgaagctcggcctggtggacgaggcggtcccgccg
ccgctgctgcggcaggtggcgcaggagcgcgccgccgcgctcgcctcgggcaagctgcgc
cgcgccccgcgccgggacgccggggcggtggcccgggtcacccgcgccgccctggaggag
aacttcctcggccgcgaggtcctgttccggcaggcgcggaagctcacgctcgcgaagacg
aaggggcactacccggcgccgctgcgcgccctcgaggccatcgagcacgggtacgcgaag
ggcttcgagaaggggctggagaaggaggccgagctgttcgggaagctcgccatgacgccg
gaggcgcaccggctcatggagatcttcttcgccaccaccgcgctcaagaaggacaacggg
gtggacgatcccgccgtgaaggcgcgcccggtgtccgcggtgggcgtgctcggcggcggc
ctcatgggcggcgggatcgcctacgtgaccgtgaacgccggcctgccggtgcgcctgcgc
gagcgggacgacgccgcggcggcgcacggggtggcggcggtgcgcggcgtcctcgacgag
cgggtgaagcgccggtcgatcgaccggctggagcgcgccgagaagctgcgcctgctcacc
accaccaccgactggtccggcctggagcgggtggacgtgctcgtcgaggcggtgttcgag
gacctggcgctgaagcaggagatggtgcgcgcgttcgaggcggtgaacccgaccggcatc
ttcgcctccaacacctcctccatccccatcggccgcatcgccgaggcgtcccgccacccc
gagaccgtgctcgggatgcactacttctccccggtccacaagatgccgctgctcgaggtg
atcgtcacgccgcgcacggcgccggaggcgaccgccaccgcggtggcgctcgggaagaag
cagggcaagacggtgatcgtggtgcgcgacgggcccggcttctacacgagccgcatcctc
gcgccgtacatgaacgaggccgcgcacctgctggtcgagggcgcggcgatcgaggacctg
gaccacgcgctggtggcgttcgggttcccggtgggccccatcaccctgctcgacgaggtc
ggcatcgacgtcggcgacaaggtcgggaagatcctgcaggaggcgttcggcgcgcggatg
gcgccgccgccggcgctgcacgacgtggtgaaggcggggcgcctgggccgcaagaacggc
aagggcttctacacctacggcggcaaggagaagcgggtggacgagaccgtctacgacctg
ctgcccgggggccgccgccgcaagcgcgtcgccgcggacgagatccaggagcggctggtg
ctgcagctcgtgaacgaggcggtccgctgcctgggcgagggcatcctgcgctcggcgcgc
gacggcgacgtcggcgcggtgttcggcctcggcttcccgccgttccgcggcgggccgttc
cgctgggccgacgcggtgggcacgaaggcgctgctcgaccggatggagcggctgcgcgcg
cggcacggcgagcgcttcgagccggcgccgctgctcgccgagctgggccgggcgggccgg
ccgttccacggcggctag

DBGET integrated database retrieval system