KEGG   Anaeromyxobacter sp. K: AnaeK_0531Help
Entry
AnaeK_0531        CDS       T00748                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AnaeK_0531
Enzymes [BR:ank01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AnaeK_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
613517..614374
Genome map
AA seq 285 aa AA seqDB search
MTPPARPPLRLAVVGHVEHVTIGRVPAVPRAGEIAHLQAPRWFPGGGGGVAFWQLARSPA
EVLLYTALGDDEAGAQVERALGAAGARVRVHAARRAEPHTRDLVLLTPDGERTIVVVGEP
LHPRADDPLPWGALSGCDAAYFTAQDPAALRAARAARLLVVTARRREALARSGVAADVVV
GSRLDAREVSARADYPVPPAALVLTEGAAGGIIETAAGVERFPAPPSPEAVGGAYGAGDS
FAGALVFFLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLPLEAP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgcccgctcgccccccgctccggctcgccgtcgtcggccacgtcgagcacgtc
accatcggccgcgtgccggcggtgccgcgcgccggcgagatcgcgcacctccaggcgccg
cgctggttcccgggcggcgggggcggggtcgcgttctggcagctcgcccgctcgccggcc
gaggtgctgctgtacaccgcgctcggcgacgacgaggccggcgcgcaggtggagcgggcg
ctcggcgcggccggcgcgcgcgtgcgcgtgcacgcggcgcgccgcgccgagccgcacacc
cgcgacctcgtcctgctcacgcccgacggcgagcggaccatcgtggtggtcggcgagccg
ctgcacccgcgcgccgacgacccgctgccctggggcgcgctgtccggctgcgacgccgcg
tacttcaccgcgcaggatcccgccgcgctccgcgccgcccgggcggcgcggctgctggtg
gtcaccgcccgccgccgcgaggcgctggcccggtccggcgtggcggccgacgtggtggtg
gggagccgcctcgacgcgcgcgaggtgagcgcgcgcgccgactacccggtgccgccggcc
gcgctcgtgctcaccgagggtgcggccggtgggatcatcgagaccgccgccggggtggag
cgcttcccggcgccgccctcgcccgaggccgtcggcggcgcctacggcgcgggcgacagc
ttcgccggcgcgctcgtgttcttcctcgcggcggggctgccgctccgcgacgcctgcgcg
gcggcgggccgccacggggcggcggtgctgcgcgcggtggacccgcgcgacggccagctc
ccgctggaggcgccgtga

DBGET integrated database retrieval system