KEGG   Anaeromyxobacter sp. K: AnaeK_0634Help
Entry
AnaeK_0634        CDS       T00748                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ank00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AnaeK_0634
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AnaeK_0634
Enzymes [BR:ank01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AnaeK_0634
Two-component system [BR:ank02022]
 CheA family
  CheA-CheYBV
   AnaeK_0634
Bacterial motility proteins [BR:ank02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AnaeK_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(717909..718958)
Genome map
AA seq 349 aa AA seqDB search
MAPRILVVDDSAVVRMALSQILGRAGLEVETAIDPLVAMDKMRRARPDAIVLDIEMPRMD
GLTFLDRVMAQDPVPVVVCSGLAGPGSEVALHALEHGAVDVIEKPRLGVKGFLEESARRI
VEVVRAATQARLRARVRALRPLPRAPAGAQPRPAPRLAARPGRAELVVVGASTGGTEALR
VLLEAMPADAPAIAVVQHMPEVFTEQFARRLDKLCRIEVKEAADGDRLLPGRALVAPGNR
HLSVKRAGGLVAVVSDGPPVSLHRPSVDVLFHSAARIAGPGTLAILLTGMGDDGADGMVE
LRRAGAHTVAQDESTSVVFGMPKEAIARGGAVEVLPLPRIAPALLAWAR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccgcgcatcctggtggtggacgactcggcggtggtccggatggcgctgtcccag
atcctgggacgggccgggctcgaggtcgagaccgccatcgacccgctggtggcgatggac
aagatgcgccgggcccgcccggacgcgatcgtcctcgacatcgagatgccgcgcatggac
gggctcacgttcctcgaccgcgtcatggcccaggatcccgtgccggtggtggtgtgctcg
ggcctggccgggccggggagcgaggtggcgctgcacgcgctggagcacggcgcggtggac
gtcatcgagaagccgcgcctcggggtgaaggggttcctggaggagtcggcgcggcggatc
gtggaggtggtccgcgccgccacgcaggcgcgcctgcgggcccgggtccgcgcgctccgc
ccgctgccccgggcgccggccggcgcccagccccggcccgccccccggctcgcggcgcgg
cccgggcgcgccgagctggtggtggtgggcgcctcgaccggcggcaccgaggcgctgcgc
gtgctgctcgaggcgatgccggccgacgcgcccgccatcgcggtggtgcagcacatgccg
gaggtgttcaccgagcagttcgcgaggcgcctcgacaagctctgccggatcgaggtgaag
gaggccgccgacggcgatcggctgctgcccgggcgcgcgctggtggcgcccggcaaccgt
cacctctcggtgaagcgcgcgggcgggctggtggcggtggtgtccgacggcccgccggtc
tcgctgcaccggcccagcgtggacgtgctgttccactcggccgcgcgcatcgcgggaccg
ggcacgctcgccatcctgctcaccggcatgggcgatgacggcgcggacgggatggtggag
ctgcggcgggccggcgcgcacacggtcgcgcaggacgagtccacctcggtggtgttcggg
atgccgaaggaggccatcgcccgcggcggggccgtcgaggtgctcccgctcccgcgcatc
gcgcccgccctgctggcctgggcgcgatag

DBGET integrated database retrieval system