KEGG   Anaeromyxobacter sp. K: AnaeK_0648Help
Entry
AnaeK_0648        CDS       T00748                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank02020  Two-component system
ank02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ank00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AnaeK_0648
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AnaeK_0648
Enzymes [BR:ank01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AnaeK_0648
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     AnaeK_0648
Two-component system [BR:ank02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AnaeK_0648
Bacterial motility proteins [BR:ank02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AnaeK_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ACG71887
UniProt: B4UCR3
Position
731141..732166
Genome map
AA seq 341 aa AA seqDB search
MSLAAGDRPIRVLVADDSELFRELLARVVAGEPGFEVAAVAADGDAAAAMARALRPDVVT
MDLHMPDADGYSGIARIMAETPTPILVLTANPTEAAGFRALSLGALDILEKPSATADLGE
YGRLIRSRLRLLAGVKVIRHLRGLRERRDAAPAHGARVEVVVIGASLGGPRALAAVLRGL
PPDFPAPIAVVQHIADGFTAGLAGWLAQESRLDVREARDGEPLRPGRVLIAPTGRHLVLG
EGVARLSEAPPVDTFRPSVTPLFTSAARQYGRRCCGVLLTGMGRDGAEGLRVIKDAGGPT
LAQDEATSAVFGMARAAVELGAVDRVLPVDEIPRALRELTR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctggccgcgggggaccggcccatccgcgtgctggtcgccgacgactcggagctg
ttccgcgagctgctcgcgcgcgtggtcgcgggcgagcccggcttcgaggtggcggcggtg
gcggcggacggcgacgcggcggcggccatggcccgcgcgctgcggccggacgtcgtcacc
atggacctgcacatgcccgacgccgacggctactcgggcatcgcgcggatcatggcggag
acgcccacgcccatcctcgtgctcaccgcgaaccccaccgaggcggcgggcttccgcgcc
ctctcgctgggcgcgctcgacatcctggagaagccgtcggccaccgccgacctgggcgag
tacgggcggctcatccgctcgcggctgcggctgctcgccggcgtgaaggtgatccgccac
ctgcgcggcctgcgggagcgccgcgacgccgcgccggcgcacggcgcccgggtggaggtg
gtggtgatcggcgcctcgctgggcggcccccgcgccctcgcggcggtgctccgcggcctg
ccgcccgacttccccgcgccgatcgccgtggtccagcacatcgccgacggcttcaccgcc
gggctcgccggctggctcgcgcaggagtcgcgcctcgacgtgcgcgaggcccgcgacggc
gagccgctgcggcccgggcgcgtgctcatcgcgcccaccggccggcacctggtcctcggc
gagggcgtggcgcggctctccgaggcgccgccggtggacacgttccgcccgtcggtgacg
ccgctcttcacctccgcggcgcggcagtacgggcggcgctgctgcggcgtgctgctcacc
ggcatgggccgggacggcgccgaggggctgcgggtcatcaaggacgcgggtggccccacg
ctggcgcaggacgaggccaccagcgcggtgttcgggatggcgcgcgccgcggtggagctc
ggggcggtggaccgggtgctgcccgtcgacgagatcccgcgcgcgctccgggagctgacg
cggtga

DBGET integrated database retrieval system