KEGG   Anaeromyxobacter sp. K: AnaeK_0748Help
Entry
AnaeK_0748        CDS       T00748                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase (EC:1.1.1.23)
  KO
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AnaeK_0748 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    AnaeK_0748 (hisD)
Enzymes [BR:ank01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AnaeK_0748 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
850595..851995
Genome map
AA seq 466 aa AA seqDB search
MLKLDSRDPGFQEAWARVCARGSDEDEAPVREAAAAIVADVRARGDLALLEHTRRHDAWD
PGSAAGLALGPADFAAAYRGLPAAARRALSLAARRIADFHRRETDAQVPARRDAAGATLS
QVVRPLERVGLYVPGGTARYPSSVLMTAVPARVAGVREIVVTSPGVKGSGEMDRWTLAAC
HVAGVARLFKVGGAQAVAALAYGTATVPAVDKICGPGNAYVAAAKRLVFGRVDIDMIAGP
SEILVLADAAADPAEVASDLLAQAEHDVRAVSVLVTPSAALARAALTAVERQLADLPRRE
IAGRSIEERGAVVVTRGLSEAVRLADAFAPEHLALHARGAAGLVKRISRAGAVFVGSSTP
EAVGDYLAGPSHVLPTAGTARFASPLSVATFRRRMSVLDLTPAALAALAPSVEALARAEG
LEGHWRAVEVRVAKRAPARPRRAAAAKAKVASRAPRARAAAGGARR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaagctcgattcccgcgatcctggcttccaagaagcgtgggcccgcgtctgcgcc
cgtgggtcggacgaggacgaggcgccggtgcgcgaggccgccgccgccatcgtggccgac
gtccgcgcccgcggcgacctggcgctgctcgagcacacccgccgccacgacgcctgggac
ccgggctccgccgccggcctggcgctcggcccggccgacttcgccgccgcgtaccgcggc
ctccccgccgcggcgcgtcgtgcgctctcgctcgccgcccggcgcatcgccgacttccac
cgccgcgagaccgacgcgcaggtgccggcccgtcgcgacgccgcgggtgcgacgctgtcg
caggtcgtccgcccgctggagcgcgtcggcctgtacgttccgggggggacggcccgctat
ccctcctcggtgctgatgaccgccgtgccggcccgcgtggccggcgtccgggagatcgtc
gtcacgtcacccggcgtgaagggcagcggcgagatggaccgctggacgctcgccgcctgc
cacgtggccggggtggcgcgcctgttcaaggtcggcggcgcgcaggcggtggcggcgctg
gcgtacggcaccgccacggttccggcggtggacaagatctgcgggccgggcaacgcgtac
gtggccgccgcgaagcggctggtgttcgggcgcgtggacatcgacatgatcgccgggccg
agcgagatcctggtgctcgccgacgcggcggcggatccggccgaggtggcgagcgacctg
ctcgcgcaagccgagcacgacgtgcgggccgtgtcggtgctggtgacgccgtcggccgcg
ctggcgcgggcggcgctgacggcggtcgagcgccagctcgccgatctgccgcgccgggag
atcgccggtcgctcgatcgaggagcgcggcgcggtggtggtgacgcgcggcctctccgag
gcggtgcggctcgccgacgcgttcgcgcccgagcacctggcgctgcacgcccgcggcgcg
gccggcctcgtgaagcggatctcgcgcgccggcgcggtgttcgtgggcagctccacgccg
gaggcggtgggcgactacctggccggcccgagccacgtgctcccgaccgccggcaccgcc
cggttcgcctcgccgctctcggtggcgacgttccgccgccgcatgagcgtgctcgacctg
acgcccgcggcgctcgccgcgctggcgccgtcggtcgaggcgctggcgcgggccgagggg
ctggaggggcactggcgcgcggtggaggtgcgggtcgcgaagcgcgcgcccgcgcggccc
cgccgggcggcggcggcgaaggcgaaggtcgcgtcgagggcgccccgcgcgcgcgccgcg
gccgggggggcgcgtcgatga

DBGET integrated database retrieval system