KEGG   Anaeromyxobacter sp. K: AnaeK_0830Help
Entry
AnaeK_0830        CDS       T00748                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AnaeK_0830
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AnaeK_0830
  Amino acid metabolism
   00310 Lysine degradation
    AnaeK_0830
Enzymes [BR:ank01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AnaeK_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
941046..942356
Genome map
AA seq 436 aa AA seqDB search
MSIQLKVPNIGESVQTATIGTWLKKEGEPVQADEPVVEVESEKATVAVPAPAAGVLRKVL
RQSGETVAIGEVIAELDEGGAAQAAGASPFGSGPVPGGTVPAARGDGAPAPAPAPAPVAP
APARAAAPAPAPAAPPPAAPAPAAGGFRASPSARRRMAELGVTAGQVEAIAAGGQIRRDD
VARALEARPAAPAPAPAAPVVAGPRERVVAMTPLRRTVARRLVEAQHTAALLTTFNEVDM
SRVLALREQHGEAFLKKHGVKLGFMSFFVKASIEALRAYPGVNGEIRGDSIVYKDHYDVG
VAVGGGKGLVVPVIRDADALSFAEVEATIGELAKKAKENRITMEDLAGGTFTISNGGIYG
SMLSTPIINPPQSGILGLHKIQKRAVVDADDQVVVRPMMYLALSYDHRLVDGREAVSFLV
KVKECIEDPERMLLEV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccagctcaaggtcccgaacatcggcgaatccgtgcagacggccaccatcggc
acgtggctcaagaaggagggcgagccggtccaggccgacgagcccgtggtggaggtggag
agcgagaaggccaccgtggcggtcccggcgcccgccgccggcgtgctgcggaaggtgctc
cggcagtccggcgagaccgtcgccatcggcgaggtgatcgccgagctggacgagggcggc
gccgcccaggccgcgggggcctcgccgttcggctccggcccggtgcccggaggcaccgtc
cccgccgcccgcggcgacggcgctccggccccggctcccgcacccgcacccgtcgctccc
gcaccggcccgggccgccgccccggcgcccgcgcccgccgcgccgccgccggccgccccc
gcgcctgccgccggcgggttccgcgcgtcgccctcggcgcgccgcaggatggccgagctg
ggcgtcacggccgggcaggtggaggcgatcgccgccggcgggcagatccgcagggacgac
gtggcccgcgcgctcgaggcgcgcccggccgcccccgcacccgcacccgcggccccggtc
gtggccggcccgcgcgagcgcgtggtcgccatgaccccgctgcgccgcacggtggcgcgc
cggctggtcgaggcgcagcacaccgcggcgctgctcaccaccttcaacgaggtggacatg
tcgcgcgtgctcgcgctccgcgagcagcacggcgaggcgttcctgaagaagcacggcgtg
aagctcggcttcatgtcgttcttcgtgaaggcgtcgatcgaggcgctgcgcgcctacccc
ggcgtgaacggcgagatccgcggcgacagcatcgtctacaaggaccactacgacgtcggc
gtggcggtgggcggcggcaagggcctggtggtcccggtgatccgcgacgcggacgcgctc
tccttcgccgaggtcgaggcgaccatcggcgagctggcgaagaaggcgaaggagaaccgc
atcaccatggaggacctcgccggcggcacgttcaccatctcgaacggcggcatctacggc
tcgatgctctcgacgcccatcatcaacccgccgcagtcgggcatcctcggcctgcacaag
atccagaagcgcgcggtggtggacgccgacgaccaggtggtggtccgcccgatgatgtac
ctggcgctctcgtacgatcaccggctggtggacggccgcgaggcggtctcgttcctcgtg
aaggtgaaggagtgcatcgaggatccggagcggatgctgctggaggtgtga

DBGET integrated database retrieval system