KEGG   Anaeromyxobacter sp. K: AnaeK_1013Help
Entry
AnaeK_1013        CDS       T00748                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ank00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AnaeK_1013
Enzymes [BR:ank01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AnaeK_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1148775..1149368
Genome map
AA seq 197 aa AA seqDB search
MIARLAGRIAEKRDDHAIVDVGGVGYLVHLSQLSLASLPPPGEPAALRVYTHVREDALDL
YGFATEDEEAVFRALIDVKGVGPRAAQNILSGIEARELAQAVAQGDVARLTKVQGIGKKT
AERLVLELKEKLVALARAAGPARAGAEADVLEQLRTALLNLGYRPPQAEGVAEALRDSAE
GRPLDDLLREALKRLRG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgcgcctggccgggcggatcgccgagaagcgcgacgaccacgccatcgtggac
gtgggcggggtcggctacctcgtgcacctctcgcagctctcgctggcctcgctcccgccg
ccgggcgagcccgccgcgctccgcgtgtacacccacgtccgcgaggacgcgctcgacctg
tacggcttcgcgaccgaggacgaggaggcggtgttccgcgccctcatcgacgtgaagggg
gtgggcccgcgcgcggcgcagaacatcctctccggcatcgaggcgcgcgagctggcgcag
gcggtggcgcagggcgacgtcgcccggctcaccaaggtccagggcatcgggaagaagacc
gccgagcggctggtgctggagctgaaggagaagctggtcgcgctggcgcgcgccgccggg
cccgcccgcgccggcgcggaggcggacgtgctcgagcagctccggaccgcgctgctcaac
ctcggctaccggccgccgcaggcggagggcgtggcggaggcgctgcgcgactcggccgag
ggccggccgctcgacgacctgctgcgcgaggcgctgaagcggctgcgcgggtag

DBGET integrated database retrieval system