KEGG   Anaeromyxobacter sp. K: AnaeK_1223Help
Entry
AnaeK_1223        CDS       T00748                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ank  Anaeromyxobacter sp. K
Brite
Enzymes [BR:ank01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     AnaeK_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1377777..1378799)
Genome map
AA seq 340 aa AA seqDB search
MNLLVTGGTGFLGAALVPLLARAGHRLRLLQRSAAPEAEALGADVRRAGLEDAEAVRAAL
DGVDAVFHLAGQVDFDPAEPARLYELHVQGTRRLLEACVAAGVRRVILASTSGTIAVSKE
ERVATEADPYPIAAVAGWPYYLSKIFQEKAALRIHRDTGLPVVVLNPSLLLGPGDARLSS
TDVVFKFLERRIPAMPTGGLSFVDVRDAARAFAAALERGRPGERYLLGGANLTFRDFFGR
LERLSGVAAPRVALPGGLNVAGARLLEKLSGWRGAEAPIDAPSVEMGEHFWYCDSRKAEE
ALGFSARDPQETLFETVRWLEQHVRARKAPETVAELLRGR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctgctcgtcaccggcggcaccggcttcctcggcgccgcgctcgtcccgctgctc
gcccgggccggccaccggctgcggctgctgcagcgctcggcggcgccggaggccgaggcg
ctcggcgccgacgtgcgccgggccgggctcgaggacgccgaggcggtccgggccgcgctc
gacggggtggacgcggtgttccacctggccggccaggtggacttcgatcccgccgagccc
gcgcgcctgtacgagctgcacgtgcaaggcacccggcggctcctcgaggcgtgcgtcgcc
gcgggcgtgcggcgggtgatcctcgcctccacctcgggcaccatcgcggtctcgaaggag
gagcgggtcgccaccgaggccgacccctaccccatcgccgcggtggcgggctggccctac
tacctctccaagatcttccaggagaaggccgcgctgcggatccaccgcgacaccggcctg
ccggtggtggtgctgaacccgtcgctgctgctcggaccgggggacgcccgcctctcctcc
accgacgtggtgttcaagttcctggagcggcgcatcccggccatgcccaccggcggcctc
tccttcgtggacgtgcgcgacgcggcgcgcgcgttcgcggcggcgctggagcgcgggcgg
cccggcgagcgctacctgctcggcggcgcgaacctcaccttccgcgacttcttcggccgg
ctggagcggctctcgggcgtggcggcgccgcgggtggcgctgcccggcggcctgaacgtc
gccggggcgcggctcctggagaagctctccgggtggcgcggcgccgaggcgcccatcgac
gcgccgtcggtcgagatgggcgagcacttctggtactgcgactcgcgcaaggcggaggag
gcgctcgggttctcggcccgcgatccgcaggagacgctgttcgagaccgtccgctggctg
gagcagcacgtgcgcgcgcgcaaggcgccggagacggtggcggagctgctccgcgggcgg
tga

DBGET integrated database retrieval system