KEGG   Anaeromyxobacter sp. K: AnaeK_1264Help
Entry
AnaeK_1264        CDS       T00748                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00330  Arginine and proline metabolism
ank01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AnaeK_1264
Enzymes [BR:ank01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AnaeK_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ACG72497
UniProt: B4UI92
Position
complement(1434527..1435552)
Genome map
AA seq 341 aa AA seqDB search
MTFDPSAAAQPGSGVFGLPHSERDAGVVLVPVPFEATTSYGGGTSRGPEAILDASRQVDL
FDVETGRPYEAGIHMLPVPEEIARLDREARAAAEPVIDAGGLVPGRQDLARAVAEVDEAC
GRVNAWVEERVAGLLARGKTVGLVGGDHSTALGAIAAHARRHPGMGLLHVDAHADLRVAF
EGFTYSHASVIYNAAERLPELSRIVQVGLRDLSEEEHAYAAASGGRIVQHHDAPLARARF
EGEPWAAQVRRIVEPLPREVYVSFDVDGLDPTLCPHTGTPVPGGLSFQEAAYLIGAVVRS
GRRIVGFDLVEVSPGPDGGDWDGNVGARLLYKLIGWALAGR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgatccttccgccgccgcacagcccggctccggcgtgttcggcctcccccac
tccgagcgcgacgccggcgtggtgctcgtcccggtgccgttcgaggcgaccacctcctac
ggcggcggcacctcgcgcggcccggaggcgatcctcgacgccagccggcaggtggacctg
ttcgacgtggagaccggccgcccgtacgaggccggcatccacatgctgcccgtccccgag
gagatcgcccggctcgaccgcgaggcgcgcgcggccgccgagccggtgatcgacgccggc
gggctcgtgcccggccgccaggacctggcccgggcggtcgccgaggtggacgaggcctgc
gggcgcgtgaacgcctgggtcgaggagcgcgtcgccggcctgctcgcccgcggcaagacc
gtcggcctggtggggggcgaccactccaccgcgctcggcgcgatcgccgcgcacgcgcgg
cgccacccgggcatgggcctgctgcacgtggacgcccacgccgacctgcgggtcgcgttc
gaggggttcacgtacagccacgcctccgtgatctacaacgcggccgagcggctcccggag
ctgtcgcggatcgtgcaggtcggcctgcgcgacctctccgaggaggagcacgcctacgcg
gccgcgtcggggggccgcatcgtgcagcaccacgacgccccgctggcgcgcgcgcggttc
gagggcgagccgtgggcggcgcaggtccggcgcatcgtcgagccgctgccgcgagaggtg
tacgtcagcttcgacgtggacgggctcgaccccaccctctgcccgcacaccggcacgccg
gtgccgggcggcctctcgttccaggaggccgcgtacctgatcggcgccgtggtgcgcagc
ggcaggcgcatcgtcggcttcgatctcgtcgaggtgtcgcccgggcccgacggcggcgac
tgggacggcaacgtgggcgcccgcctgctctacaagctgatcggctgggcgctggccggg
cgctga

DBGET integrated database retrieval system