KEGG   Anaeromyxobacter sp. K: AnaeK_1364Help
Entry
AnaeK_1364        CDS       T00748                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ank00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1550329..1551123
Genome map
AA seq 264 aa AA seqDB search
MPAAPARPLAGRTVVVTRGKGSEGKDALAARLEELGAEVRALPSIAFAPPADPAPLDAAL
RALDRFDWAVFTSANAVDRTVERLRALGLDPAALGRLRLAAVGPATAERLAAAVRAPDVV
PVEAKGDVLARTLGDQVRGRRVLFPRPAEGRPETVAGLLAAGAELTAVEAYRTVPAPAEA
LAHLAGWLAAGDVAAVAFASPSAVAAVLAALGDRSALLRGVLIAAIGPTTADALREAGLP
VGAVPAHYTGRDLAEAIAERLGPG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccgcgcccgcgcggccgctggccggccgcaccgtggtggtgacccggggcaag
ggctccgagggcaaggacgcgctcgcggcccggctcgaggagctgggcgcggaggtgcgc
gcgctgccgtcgatcgcgttcgccccgcccgccgatcccgcgccgctcgacgccgccctc
cgcgcgctcgaccgcttcgactgggcggtgttcaccagcgcgaacgcggtggaccggacg
gtggagcggctgcgcgcgctcggcctcgatccggccgcgctgggccggctccgcctcgcc
gccgtcgggcccgccaccgccgagcggctggcggcggcggtgcgcgcgccggacgtggtg
ccggtcgaggcgaagggggacgtgctcgcccgcaccctgggcgaccaggtccgcggccgg
cgggtgctgttcccgcgcccggccgaggggcggcctgagaccgtggccgggctcctcgcc
gccggggccgagctgaccgcggtcgaggcgtaccggacggtccccgcgcccgccgaggcg
ctggcgcacctggcgggctggctcgcggccggtgacgtcgcggcggtcgccttcgcgtcg
ccctcggcggtggcggccgtgctggcggcgctcggtgaccggtcggccctcctccgaggg
gtgctgatcgcggcgatcgggcccaccaccgcggacgcgttgcgcgaggcggggctcccg
gtgggcgccgtcccggcgcactacaccggccgagacctcgcggaggccatcgccgagcgg
ctcggccccgggtag

DBGET integrated database retrieval system