KEGG   Anaeromyxobacter sp. K: AnaeK_1461Help
Entry
AnaeK_1461        CDS       T00748                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ank00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1657393..1659255
Genome map
AA seq 620 aa AA seqDB search
MADTKLWTRIAVALAAAGALALVVGCPPSKPKGSKRPAAASDIAVAAEKTYVPPGDLDEY
YMFSSGGHSGQVYVYGIPSMRHITTIPVFAPYSGTGYGFDDESKAMLGNLTWGDVHHPAL
SETGGDYDGRWLFVNEMNGRVARIDLRDFKTRQIIGPVPNISGNHGSTFITPNSEYILMS
SRFSIPIPKGKAVSIDRYASEYKGVAAGIKVDPKSGQMSLGWQVLLPPFDWDLGDAGKKL
SEGWFFLTCYNSERATGKLEVTASQRDRDYIAAIDWRLAEKAAAEGKGELIGGVKVLDPK
TVPGLVYLLPCGKSPHGVDVSPDGKYVVGSGKLQGVTTAFNFEKVLTAIKNKDFAGEEDG
IPVLKYESIKDAEVPVGLGPLHTQFGPDGMAYTSLFVDSALAKWKLGTWEVLDKVPMSYS
TGHLAAAEGDTVSPDGKWLVGLNKLSHGRHLPVGPSQPESSQLVDISGDKMKLVYDAFTE
PEPHYAQIIKADKLKPIEVYPKEENKHPLAIWDVKDAGVTRKGNEVLAKVVVVRSSMTPA
LIEVNEGDTVKVALTNIEQTTDELHGFGLLDYNINVVLDPGETKTVTFKADKPGVFPYYC
TNFCSALHQEMQGYLVVKPK
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaagctctggacgaggatcgccgtggcgctcgcggcggcgggggcgctg
gcgctcgtggtgggctgcccgcccagcaagccgaagggctcgaagcgtcccgccgccgcg
tcggacatcgcggtggcggcggagaagacctacgtcccgcccggcgacctcgacgagtac
tacatgttctcgtccggcggtcactccgggcaggtctacgtctacggcatcccgtcgatg
cgccacatcaccaccataccggtgttcgcgccgtactcgggcaccggctacggcttcgac
gacgagtcgaaggccatgctcggcaacctgacctggggtgacgtgcaccacccggcgctc
tccgagaccggcggcgactacgacgggcgctggctgttcgtgaacgagatgaacgggcgc
gtggcgcgcatcgacctgcgcgacttcaagacgcggcagatcatcgggccggtgccgaac
atctcgggcaaccacgggtccaccttcatcacgccgaacagcgagtacatcctcatgtcc
tcgcggttctccatccccatccccaaggggaaggcggtgtcgatcgaccggtacgccagc
gagtacaagggcgtcgcggccgggatcaaggtcgacccgaagtccggccagatgtcgctg
ggctggcaggtgctcctgccgccgttcgactgggacctcggggacgccggcaagaagctg
tcggagggctggttcttcctcacctgctacaactccgagcgcgccaccgggaagctcgag
gtcaccgcctcgcagcgcgaccgcgactacatcgcggccatcgactggcgcctggccgag
aaggcggcggcggaggggaagggcgagctgatcggcggcgtgaaggtgctcgatccgaag
accgtccccgggctcgtgtacctgctgccctgcgggaagtcgccgcacggcgtggacgtc
tcgcccgacggcaagtacgtggtcggctccggcaagctccagggcgtcaccaccgccttc
aacttcgagaaggtcctcaccgccatcaagaacaaggacttcgccggcgaggaggacggc
atcccggtcctcaagtacgagtccatcaaggacgcggaggtgccggtggggctcgggccg
ctgcacacgcagttcgggcccgacgggatggcgtacacctcgctgttcgtggacagcgcg
ctcgcgaagtggaagctcgggacctgggaggtcctggacaaggtcccgatgtcctactcg
accggccacctcgccgcggccgagggcgacaccgtctcgccggacgggaagtggctggtg
ggcctcaacaagctgtcccacgggcggcacctccccgtcggaccctcgcagcccgagtcc
tcgcagctcgtggacatctcgggcgacaagatgaagctcgtctacgacgcgttcaccgag
cccgagccgcactacgcgcagatcatcaaggcggacaagctgaagccgatcgaggtctac
cccaaggaggagaacaagcacccgctggcgatctgggacgtgaaggacgcgggggtgacg
cgcaagggcaacgaggtgctggcgaaggtggtggtggtgcggtccagcatgacgccggcg
ctcatcgaggtgaacgagggcgacacggtcaaggtcgcgctcaccaacatcgagcagacc
accgacgagctccacggcttcgggctgctcgactacaacatcaacgtcgtcctcgatccc
ggcgagaccaagaccgtcaccttcaaggccgacaagccgggcgtcttcccctactactgc
acgaacttctgctccgcgctgcaccaggagatgcagggttatctcgtggtgaagccgaag
tag

DBGET integrated database retrieval system