KEGG   Anaeromyxobacter sp. K: AnaeK_1653Help
Entry
AnaeK_1653        CDS       T00748                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00630  Glyoxylate and dicarboxylate metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01200  Carbon metabolism
Module
ank_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AnaeK_1653
Enzymes [BR:ank01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AnaeK_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACG72882
UniProt: B4ULM4
Position
complement(1868153..1870399)
Genome map
AA seq 748 aa AA seqDB search
MDFEQEVAALRRWFESPRFAGIRRIHTAREVVEQRGTIRQDYPVAREAAEAFHARLRELF
QQRRCITTFGPYSPGQAVAMKRMGIEAIYLGGWATSAKGSVQEDPGPDLASYPLSQVPDE
AAPIVRALLTADRNQHHARSRMTEEQRRATPAVDFRPFIIADADTGHGGDAQVRNLVRRF
VEVGVPGYHIEDQKPGVKKCGHQGGKVLVAEDEQLKRLSAARFQLDLMGVPGIVVARTDA
ESATLLDGRGDERDQPFILGASNLAVPAFRAAFLAILRRFRRAGVEELSGHELYAVCDEE
YAAADAWLERTGFDKAIAAAAAEHQRGALAVDAALDRVFDRFVDAWQQEAGVCTYAEAVA
QAIAFREHEGEHPTMRRDEWMAFAARAPFYRAREKARAMGIETPWDCEHAKTPDGYYQVR
GGIDYAIQKSLAAAPFADLLWMETKTADLADARRFADAIHAVHPDKMLAYNLSPSFNWDT
TGMDDEQMRRFPEELGKLGYVFDFITYGGHQIDGLAAEEFATALREDGMLALARLQRKFR
LLESGYRTPQTLVGGPRLDAALMAVSGRTATTKAMGQGSTQHQHLVQTEVPPRLLEDWLD
LWRERHGVQGKLRAALRPVTAGSDLLELVVTSADGERKLDVTFASITDRRGRSILSVRDQ
NTHDLALRRKRLMTLAQLFLFHRYRVDSAHYVTPTEDNQRQAEGMKALGLFRSVAQEVGE
IIVADVDRARVKALAARDHVALKALLGA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgagcaggaggtcgcggccctgcgccgctggttcgagagcccacggttcgcg
ggcatccggcgcatccacaccgcgcgcgaggtggtggagcagcgcggcacgatccgccag
gactacccggtggcgcgggaggccgccgaggcgttccacgcgcgcctgcgcgagctgttc
cagcagcggcgctgcatcaccaccttcggcccctactcgcccggccaggccgtggcgatg
aagaggatgggcatcgaggccatctacctgggcggctgggccacctcggcgaagggctcg
gtgcaggaggaccccggccccgacctcgccagctacccgctcagccaggtgcccgacgag
gcggcgcccatcgtgcgcgcgctgctcacggcggaccggaaccagcaccacgcccgctcg
cgcatgaccgaggagcagcggcgcgccaccccggcggtggacttccggccgttcatcatc
gccgacgccgacaccggccacggcggcgacgcgcaggtgcgcaacctcgtccgccgcttc
gtcgaggtcggcgtgcccggctaccacatcgaggaccagaagccgggcgtgaagaagtgc
gggcaccagggcggcaaggtgctcgtcgccgaggacgagcagctgaagcgcctctccgcg
gcgcggttccagctcgacctcatgggcgtgcccgggatcgtggtggcgcgcaccgacgcg
gagtcggccacgctgctcgacggccgcggcgacgagcgcgaccagccgttcatcctgggc
gcgagcaacctcgccgtcccggcgttccgcgcggcgttcctggcgatcctgcgccggttc
cgtcgcgccggcgtggaggagttgtccggccacgagctgtacgccgtgtgcgacgaggag
tacgcggccgccgacgcgtggttggagcggaccggcttcgacaaggccatcgcggccgcc
gccgccgagcaccagcgcggcgcgctcgcggtggacgccgcgctcgaccgggtgttcgac
cggttcgtggacgcctggcagcaggaggccggcgtctgcacctacgccgaggcggtggcg
caggcgatcgcgttccgcgagcacgagggcgagcacccgaccatgcgccgggacgagtgg
atggcgttcgccgcccgggcgccgttctaccgggcgcgcgagaaggcgcgcgccatgggg
atcgagacgccctgggactgcgagcacgccaagacgccggacggctactaccaggtgcgc
ggcggcatcgactacgccatccagaagtcgctcgcggcggcgccgttcgccgacctgctc
tggatggagaccaagacggccgacctcgccgacgcgcggcgcttcgccgacgccatccac
gcggtccacccggacaagatgctcgcctacaacctgtccccgtcgttcaactgggacacg
accggcatggacgacgagcagatgcgccgcttccccgaggagctcggcaagctcgggtac
gtgttcgacttcatcacctacggcggccaccagatcgacgggctggcggcggaggagttc
gcgacggccctgcgcgaggacggcatgctggcgctggcgcggctgcagcggaagttccgc
ctgctcgagtccggctaccggacgccgcagacgctggtgggcgggccgcgcctcgacgcg
gcgctcatggccgtctccggccggaccgccaccaccaaggccatgggccagggctccacc
cagcaccagcacctggtgcagaccgaggtgccgccgcggctgctggaggactggctcgac
ctgtggcgcgagcggcacggggtccagggcaagctgcgcgcggcgctccggccggtcacc
gccggctccgacctgctcgagctggtggtcacgtcggccgacggcgagcggaagctcgac
gtcaccttcgcgagcatcaccgaccggcgcgggcgcagcatcctgtcggtccgcgaccag
aacacgcacgacctggcgctgcggcgcaagcggctcatgaccctcgcgcagctgttcctg
ttccaccgctaccgcgtggactcggcgcactacgtcacgcccaccgaggacaaccagcgg
caggcggagggcatgaaggcgctcggcctgttccgctcggtggcgcaggaggtcggcgag
atcatcgtcgccgacgtggaccgggcccgggtgaaggcgctcgccgcgcgggatcacgtg
gcgctgaaggcgctcctcggcgcctga

DBGET integrated database retrieval system