KEGG   Anaeromyxobacter sp. K: AnaeK_1792Help
Entry
AnaeK_1792        CDS       T00748                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AnaeK_1792
   01230 Biosynthesis of amino acids
    AnaeK_1792
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_1792
   00030 Pentose phosphate pathway
    AnaeK_1792
   00051 Fructose and mannose metabolism
    AnaeK_1792
   00052 Galactose metabolism
    AnaeK_1792
  Energy metabolism
   00680 Methane metabolism
    AnaeK_1792
Enzymes [BR:ank01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AnaeK_1792
Protein phosphatases and associated proteins [BR:ank01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AnaeK_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2038007..2039191)
Genome map
AA seq 394 aa AA seqDB search
MTKKRVGILTGGGDVPGLNSVIKSVVYRGAEHDIEVVGIRRGWEGLTHLDLTDSASKARY
VWPLDRENTRTIDRTGGTILHSSRTNPAKMKKLPPHLQGTSFPTSTSTKGGTATTTFDVS
KQVLANLEALGLDYLLAIGGDDTLSYAARLHDLGFKVIAIPKTMDNDVRNTEYCIGFSTA
ITRAMDAIERQRTTVGSHERIGVFRVFGRDAGFTSLYTAYVTSIRCLIPEHKPKIEHVVD
LLVTDKRDNPSGYALIVLSEGAQWEGYAVQEYGDPDAFGHRKKASVGESLSDEIKRRTGE
ETIVSDLTYDLRSGDPDFIDKLIAYTFGTMAFDAVLEGKSGLMSALVDGRYDLVPIPDPK
LGPRKVDVASMYNTDRLRPIYANKRGLPVFLNKI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaagcgcgtcggcatcctcaccggcggcggcgacgtccccggcctgaacagc
gtcatcaagagcgtcgtgtaccgcggcgccgagcacgacatcgaggtcgtgggcatccgg
cgcgggtgggaggggctcacccacctcgacctcaccgactccgccagcaaggcgcgctac
gtctggccgctcgaccgcgagaacacccgcaccatcgaccggaccggcggcaccatcctc
cactcctcgcggacgaatcccgcgaagatgaagaagctgccgccgcacctgcaggggacg
tcgttcccgacctcgaccagcaccaagggcgggacggccaccaccaccttcgacgtctcg
aagcaggtgctcgcgaacctggaggcgctcgggctcgactacctgctcgccatcggcggc
gacgacacgctgtcctacgcggccaggctccacgacctcgggttcaaggtcatcgcgatc
ccgaagaccatggacaacgacgtccggaacaccgagtactgcatcgggttctcgaccgcg
atcacccgcgccatggacgcgatcgagcgccagcgcaccacggtcggctcgcacgagcgc
atcggcgtcttccgggtgttcggccgcgacgcggggttcacctcgctctacaccgcctac
gtcacctcgatccgctgcctcatccccgagcacaagccgaagatcgagcacgtggtggac
ctgctggtcaccgacaagcgcgacaacccctcgggctacgcgctcatcgtgctctccgag
ggcgcgcagtgggagggctacgcggtgcaggagtacggcgaccccgacgcgttcggccac
cgcaagaaggccagcgtgggcgagtcgctctccgacgagatcaagcggcgcaccggcgag
gagacgatcgtctccgacctgacctacgacctgcgctcgggcgatcccgacttcatcgac
aagctcatcgcgtacaccttcggcaccatggcgttcgacgcggtgctggagggcaagagc
ggcctcatgtcggcgctggtggacgggcgctacgacctcgtccccatccccgacccgaag
ctcgggccccgcaaggtggacgtggcgagcatgtacaacaccgaccgcctgcgcccgatc
tacgcgaacaagcgcgggctgccggtgttcctcaacaagatctga

DBGET integrated database retrieval system