KEGG   Anaeromyxobacter sp. K: AnaeK_1827Help
Entry
AnaeK_1827        CDS       T00748                                 

Gene name
purT
Definition
phosphoribosylglycinamide formyltransferase 2
Orthology
K08289  
phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ank00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ank00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2077865..2079028)
Genome map
AA seq 387 aa AA seqDB search
MRKKILLLGSGELGKEFTIAAQRLGQEVIAVDSYDGAPAQQVAHAREVVSMLDGAALDAL
VAKHRPDVIVPEIEAIRTERLQAYEAQGVQVVPSARAAAVTMNRRAIRDLAARELGVATA
RYAYASTPEAFRTAVREIGLPCVVKPLMSSSGKGQSVVRAEGDLEAAWSYAMSGTRGDLR
EVIVEEFIPFESEITLLTVTQRRGETLFCPPIGHRQERGDYQESWQPHPVPAPLLEEARR
MAAAVTRALGGAGIFGVEFFLGKDRVWFSELSPRPHDTGMVTLAGTQPLNEFELHLRAVL
GLPIPPVTLVRPGASAVILAHGTGAPAVRGLEAALSEPGADVRIFGKPALRPHRRMGVAL
VAGTPGDDPRALVERARAVAARVTVDP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagaagatcctgctcctcggctccggcgagctcggcaaggagttcaccatcgcg
gcgcagcgcctcggccaggaggtgatcgccgtcgactcctacgacggcgcgcccgctcag
caggtggcccacgcgcgcgaggtcgtgagcatgctcgacggcgcggcgctcgacgcgctg
gtcgcgaagcaccggcccgacgtgatcgtcccggagatcgaggccatccgcaccgagcgc
ctccaggcgtacgaggcgcagggcgtccaggtcgtcccgagcgcccgcgccgccgcggtc
accatgaaccgccgcgccatccgcgacctcgccgcccgcgagctcggggtcgccaccgcg
cgctacgcctacgcctcgacgcccgaggcgttccgcacggcggtccgcgagatcggcctc
ccctgcgtggtgaagccgctcatgtcctcgtcgggcaaggggcagagcgtggtgcgcgcc
gagggcgacctcgaggccgcctggtcctacgcgatgtccggcacccgcggcgacctgcgc
gaggtgatcgtcgaggagttcatcccgttcgagtcggagatcacgctcctcaccgtcacc
cagcggcgcggcgagacgctgttctgcccgcccatcggccaccgccaggagcgcggcgac
taccaggagagctggcagccgcacccggtgccggcgccgctcctcgaggaggcgcggcgg
atggcggcggcggtgacccgcgcgctcggcggcgcgggcatcttcggcgtggagttcttc
ctggggaaggaccgggtctggttctcggagctgtcgccgcgaccgcacgacaccgggatg
gtgacgctggccggcacgcagccgctcaacgagttcgagctgcacctgcgcgcggtgctc
ggcctgcccatcccgccggtcacgctggtccggccgggcgcgagcgcggtgatcctggcg
cacggcaccggcgcgccggcggtgcgcgggctggaggcggcgctctccgagccgggggcc
gacgtgcgcatcttcgggaagccggcgctgcgcccgcaccggcgcatgggcgtggcgctc
gtcgcgggcacgcccggcgacgatccgcgcgcgctggtggagcgggccagggcggtcgcc
gcccgcgtcaccgtcgatccgtag

DBGET integrated database retrieval system