KEGG   Anaeromyxobacter sp. K: AnaeK_2035Help
Entry
AnaeK_2035        CDS       T00748                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AnaeK_2035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_2035
   00020 Citrate cycle (TCA cycle)
    AnaeK_2035
   00620 Pyruvate metabolism
    AnaeK_2035
Enzymes [BR:ank01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AnaeK_2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2283517..2284839
Genome map
AA seq 440 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVAPGDAITEDQPLVEVMTDKATVVIPSPKRGTVVKLF
WNVGDVAKVHSPLVEIELDDAPPRPAPEAPVRAATAAATAQAAAAASVAVGRPAHPEEAT
PAAAPAAPAPAGAKALATPAVRAMARELGIDVNTVPGTGPGGRVTKDDLSRARGKVNGHG
GETEVPAPAPAAARAPVPAPSPAGPPEADERIPLRGMRRKIAENMARSKRTAAHFTFVEQ
ADVTELVRVKDRIAAAAKEEGVRVTFLPFVVKAVVAALRKFPKLNASLDDERGEIVVKHR
YDLGVASATDAGLVVPVIRAADRRSLLDLAREIERLSQDTKAGRIRPEDLGSSTFTITSL
GALGGLFATPVLNHPEVGILGIHRIRPTPVVRDGQIVARDVMHVSLTSDHRVVDGHEAAA
FTYQVIKYLEDPNLLFMQMV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaagctcgagctccccgacatcggcgagggggtcgtcgaggcggaggtccag
cagtggttcgtcgccccgggcgacgcgatcaccgaggaccagccgctcgtcgaggtgatg
accgacaaggcgacggtggtgatcccgtcgccgaagcgcggcacggtcgtgaagctgttc
tggaacgtgggagacgtggccaaggtgcactcgccgctggtcgagatcgagctcgacgac
gcgccgccgcgcccggcgcccgaggcgccggtgcgcgccgccaccgcggcggcgacggcg
caggcggccgcggcggcgtcggtggcggtcggccgccccgcccacccggaggaggccacg
ccggcggccgcacccgccgcccccgcgcccgcgggcgcgaaggcgctcgccacccccgcc
gtgcgcgccatggcgcgggagctggggatcgacgtgaacacggtgccgggcaccggcccg
ggcggccgcgtcaccaaggacgacctgtcgcgcgcccgcggcaaggtgaacgggcacggc
ggcgagacggaggtgccggccccggcgcccgccgcggcccgcgccccggtgccggcgccg
tcgccggccggcccgccggaggcggacgagcgcatcccgctgcgcggcatgcggcggaag
atcgccgagaacatggcgcgctcgaagcggaccgccgcccacttcacgttcgtggagcag
gcggacgtcaccgagctggtccgggtgaaggaccggatcgccgccgccgcgaaggaggag
ggcgtccgcgtgacgttcctgccgttcgtggtgaaggcggtcgtcgcggcgctgcgcaag
ttcccgaagctgaacgcgtcgctcgacgacgagcgcggcgagatcgtggtgaagcaccgg
tacgacctgggcgtcgcctcggccaccgacgcgggcctggtggtcccggtgatccgcgcg
gccgatcgccgctcgctcctcgatctcgcccgggagatcgagcggctctcgcaggacacc
aaggccgggcgcatccgccccgaggacctgggcagctccacgttcaccatcaccagcctg
ggcgcgctgggcgggctgttcgccaccccggtgctgaaccaccccgaggtcggcatcctg
ggcatccaccgcatccggcccacgccggtggtgcgcgacgggcagatcgtcgcccgcgac
gtgatgcacgtctcgctcacgagcgaccaccgcgtggtggacgggcacgaggcggccgcg
ttcacctaccaggtgatcaagtacctcgaggatcccaacctgctgttcatgcagatggtg
tga

DBGET integrated database retrieval system