KEGG   Anaeromyxobacter sp. K: AnaeK_2131Help
Entry
AnaeK_2131        CDS       T00748                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ank01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ank01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2392927..2393790
Genome map
AA seq 287 aa AA seqDB search
MPRDPDRIDWLPSLPFFAAHLVALATPWLAPLEWRWGALAAGLYALRMFAVTAGYHRYFS
HRSYRTSRAFQLLLAVLGASAAQKGPLWWAAHHRDHHRHSDGPEDVHSPLERGFWWSHVG
WILSRRHHETKLDRVRDLARFPELRWIDRHHLVPPAALATGLFLAGGLPALLWGFFVSTV
ALWHGTFVINSLAHVFGRRRYATDDGSRNSLVLALVTLGEGWHNNHHFYAASARQGFFWW
EIDLSWYALRALAAVRLVRDLKVPPPQVRLAHLRTAIPPAAARAEAL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgaccccgaccgcatcgactggctgccctcgctcccgttcttcgccgcgcac
ctcgtggcgctggccaccccgtggctggcgccgctcgagtggcgctggggcgcgctcgcg
gccgggctgtacgcgctgcgcatgttcgcggtgacggccgggtaccaccggtacttctcg
caccgcagctaccggacctcgcgcgcgttccagctcctgctcgcggtgctcggcgcgagc
gcggcgcagaagggcccgctctggtgggccgcccaccaccgcgaccaccaccgccactcc
gacggaccggaggacgtccactcgccgctggagcgggggttctggtggagccacgtgggc
tggatcctctcccgccgccaccacgagacgaagctcgaccgcgtgcgcgacctcgcgcgc
ttcccggagctgcggtggatcgaccgccaccacctggtgccgccggcggcgctcgccacc
gggctgttcctggcgggcgggctgccggcgctgctgtgggggttcttcgtctccaccgtc
gcgctctggcacggcacgttcgtcatcaactcgctcgcgcacgtgttcggccgccgccgc
tacgccaccgacgacggctcgcgcaacagcctggtcctcgcgctcgtgacgctgggcgag
gggtggcacaacaaccaccacttctacgcggccagcgcgcggcagggcttcttctggtgg
gagatcgacctgtcctggtacgcgctgcgcgcgctcgcggcggtgcgcctggtccgcgac
ctgaaggtcccgccgccgcaggtccgcctggcgcacctccggacggccatcccgcccgcc
gcggcgcgcgccgaggcgctctga

DBGET integrated database retrieval system