KEGG   Anaeromyxobacter sp. K: AnaeK_2335Help
Entry
AnaeK_2335        CDS       T00748                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AnaeK_2335 (tpiA)
   01230 Biosynthesis of amino acids
    AnaeK_2335 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_2335 (tpiA)
   00051 Fructose and mannose metabolism
    AnaeK_2335 (tpiA)
   00562 Inositol phosphate metabolism
    AnaeK_2335 (tpiA)
Enzymes [BR:ank01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AnaeK_2335 (tpiA)
Exosome [BR:ank04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AnaeK_2335 (tpiA)
  Exosomal proteins of bladder cancer cells
   AnaeK_2335 (tpiA)
  Exosomal proteins of melanoma cells
   AnaeK_2335 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2617159..2617920)
Genome map
AA seq 253 aa AA seqDB search
MARTKFVCGNWKMHKTVAEAVQLVKELAAGLGDAAGKVQVAVAPPFTALHAAAQAAAGSA
VEVAGQDVHWEVQGAFTGEVSAAMLAEAGCRHGIVGHSERRQLFGETDEAVRRKAEALLA
AGLAPIVCVGETLAEREAGRTLEVVDRQVRQGLAGLDAGALGRVTVAYEPVWAIGTGKTA
TAAQAQEVHAAIRKILRDLGGSVSDAIRIQYGGSVKPENAQELMSQPDVDGALVGGASLK
AKDFLAIVKGALR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcaccaagttcgtctgcggcaactggaagatgcacaagacggtcgccgaggcg
gtccagctcgtgaaggagctggccgccgggctcggcgacgccgccgggaaggtgcaggtg
gcggtggcgccgcccttcaccgccctccacgccgccgcgcaggccgcggccggctcggcg
gtcgaggtcgcggggcaggacgtgcactgggaggtccagggcgcgttcaccggcgaggtg
tccgccgcgatgctggcggaggcgggctgccgccacggcatcgtgggccacagcgagcgg
cgccagctgttcggcgagaccgacgaggccgtccgcaggaaggccgaggcgctgctcgcc
gccgggctcgcgcccatcgtctgcgtcggcgagacgctcgccgagcgcgaggccggccgg
acgctggaggtggtcgaccggcaggtgcggcaggggctcgccgggctggacgccggcgcg
ctgggccgggtgacggtcgcctacgagccggtgtgggccatcggtaccgggaagaccgcc
accgccgcccaggcgcaggaggtccacgccgccatccggaagatcctccgcgatctgggg
ggttccgtgtcggacgcgatccggattcaatacggcggctcggtgaagcccgagaacgct
caggagctcatgtcccagcccgacgtcgacggcgcgctcgtcggcggggccagcctcaag
gcgaaggatttcctcgccatcgtgaaaggtgcactccgttga

DBGET integrated database retrieval system