KEGG   Anaeromyxobacter sp. K: AnaeK_2442Help
Entry
AnaeK_2442        CDS       T00748                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AnaeK_2442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_2442
  Lipid metabolism
   00071 Fatty acid degradation
    AnaeK_2442
  Amino acid metabolism
   00350 Tyrosine metabolism
    AnaeK_2442
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AnaeK_2442
   00626 Naphthalene degradation
    AnaeK_2442
Enzymes [BR:ank01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AnaeK_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2735509..2736492
Genome map
AA seq 327 aa AA seqDB search
MRAMVLARPGAPLAAVELPDPVPGPGELRLRVGACGVCRTDLHVADGELPDPKLPLVLGH
EIVGVVDRVGAGVTRFRPGDRVGIPWLGWTCGRCAACRSGRENLCSAARFTGYHRDGGYA
ELAVADARYAFAIPGDYEDADAAPLLCAGLIGHRAWTPVRGAQRLGLYGFGAAAHLVVQL
ARHAGQRVFAFTRPGDAEAQAFALQLGAEWAGASGEVPPEPLDAAILFAPVGALVPVALR
DVVPGGTVVCAGIHMSDIPSFPYALLWGERTLRSIANLTRADGDALLALAPEVPLRTEVV
PYPLERANDALADLRAGRLRGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatggtcctcgcccgcccgggcgccccgctcgccgcggtggagctccccgat
cccgtccccggacccggcgagctgcgcctccgcgtgggcgcctgcggcgtgtgccgcacc
gacctgcacgtcgccgacggggagctgccggacccgaagctgccgctggtgctcggccac
gagatcgtgggcgtggtggatcgcgtcggggccggcgtgacccgcttccggcccggcgat
cgggtggggatcccgtggctgggctggacgtgcggccgctgcgcggcctgccggagcggc
cgggagaacctgtgcagcgcggcgcggttcaccggctaccaccgcgacggcggctacgcc
gagctggccgtcgcggacgcgcgctacgcgttcgccatccccggcgactacgaggacgcc
gacgcggcgccgctgctctgcgccggcctcataggccaccgcgcctggacgcccgtgcgc
ggcgcccagcggctcggcctctacggcttcggggccgcggcgcacctggtggtgcagctc
gcccggcacgcggggcagcgcgtgttcgcgttcacccgccccggcgacgccgaggcgcag
gcgttcgcgctgcagctcggggccgagtgggccggcgcctcgggcgaggtgccgcccgag
ccgctcgacgccgccatcctgttcgcgccggtgggcgcgctcgtgcccgtcgcgctccgc
gacgtggtgccgggcggcaccgtggtctgcgccggcatccacatgagcgacatcccctcg
ttcccgtacgcgctgctgtggggcgagcggaccctccgctcgatcgcgaacctcacccgc
gccgacggcgacgcgctgctcgcgctcgcgcccgaggtcccgctccgcaccgaggtcgtc
ccgtacccgctggagcgcgccaacgacgcgctcgccgacctccgcgccggccggctgcgc
ggggcggcggtgctggtgccgtga

DBGET integrated database retrieval system