KEGG   Anaeromyxobacter sp. K: AnaeK_2692Help
Entry
AnaeK_2692        CDS       T00748                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ank00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3010108..3010785)
Genome map
AA seq 225 aa AA seqDB search
MSSDAAHERLPGLLLVLSAPSGAGKTTLAHRLRDASPDAVFSISATTRAPRGAEREGVDY
HFVTAERFAELVAQGAFAEWAEVHGQRYGTLRATVEQALAAGKLALFDIDVQGGAQIKAA
WPQQAATVLVLPPDEAELERRLRGRDTDSDETIRRRLVAARAEVARGLGSYDYVVVNDVL
EGALAQLQAIVRHERLRHAGRWDPEAARVAEACRRSAAPLGGWAS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgacgccgcgcacgagcggctcccggggctgctgctggtgctctcggcgccg
tcgggggcggggaagaccacgctcgcgcaccggctgcgggacgcctcgcccgacgccgtg
ttctcgatctcggccaccacccgcgcgccgcgcggcgccgagcgcgagggcgtggactac
cacttcgtcaccgcggagcggttcgccgagctggtggcgcagggcgcgttcgcggagtgg
gccgaggtgcacggccagcgctacgggacgctgcgcgccacggtggagcaggcgctcgcc
gccgggaagctcgcgctgttcgacatcgacgtgcagggcggggcgcagatcaaggcggcg
tggccgcagcaggccgccaccgtgctcgtgctgccgccggacgaggcggagctggagcga
cggctgcgcgggcgcgacaccgacagcgacgagacgatccgccggcgcctggtggcggcg
cgcgccgaggtcgcgcgcggcctcggctcgtacgactacgtggtggtgaacgacgtgctg
gagggcgccctcgcgcagctccaggcgatcgtgcggcacgagcggctgcgccacgccggg
cggtgggatccggaggccgcgcgggtggcagaggcctgccgccgcagcgccgcgccgctc
ggcggctgggcgtcctag

DBGET integrated database retrieval system