KEGG   Anaeromyxobacter sp. K: AnaeK_2705Help
Entry
AnaeK_2705        CDS       T00748                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00010  Glycolysis / Gluconeogenesis
ank00620  Pyruvate metabolism
ank00640  Propanoate metabolism
ank00680  Methane metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01130  Biosynthesis of antibiotics
ank01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AnaeK_2705
   00620 Pyruvate metabolism
    AnaeK_2705
   00640 Propanoate metabolism
    AnaeK_2705
  Energy metabolism
   00680 Methane metabolism
    AnaeK_2705
Enzymes [BR:ank01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AnaeK_2705
Lipid biosynthesis proteins [BR:ank01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AnaeK_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACG73930
UniProt: B4UHR0
Position
complement(3024363..3026069)
Genome map
AA seq 568 aa AA seqDB search
MSSTDVFRRARDFLVTHREDYETAYREFRWPVLDRFNWALDWFDMIADGNGRTALHIIED
YGAELRLSYVELAERSNRVATYLRRHGVERGHRVLMMLPNCVQIWEVMLASMKLGACVIP
ATSLLTPEDVQDRIERGRVGHVITDAAGTEKFRVVNGTFTRHVVGEAVPGWMQYEDAYDE
GSFFLPHGETLASDPVLLYFTSGTTAKPKLVVHTHKSYPVGHLSTMYWIGLREGDKHLNV
SSPGWAKHAWSSFFAPFNAGATVCVYNYARFSAARTLEVLARHQITTLCAPPTVWRMLIL
EDLAKHPVKLRELLSAGEPLNPEVIEKVRQAWGITIRDGYGQTETTCQIGNSPGQPLKPG
SMGRPLPGYRIALLDEEGRPAAEEGEICIDLEARPASLMAGYEGDANLNDFVTRHGHYHT
GDVATRDEEGYITYVGRSDDVFKSSDYRISPFELESALIEHDAVAEAAVVPSPDAVRGLL
PKAFIILKPGRTPDRELALEIFRFLRRRLAPYKRIRRLEFSELPKTVSGKIRRVELRRRE
QARAPSAPRGPLEFWQEDFPELAAGEGR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaccgacgtctttcgccgcgcccgcgacttcctggtcacccaccgcgaggat
tacgagaccgcgtaccgcgagttccgctggccggtgctcgaccggttcaactgggcgctg
gactggttcgacatgatcgcggacggcaacggccgcaccgcgctgcacatcatcgaggac
tacggcgccgagctgcggctgtcctacgtcgagctggccgagcgctccaaccgcgtggcg
acctacctgcgccgccacggcgtggagcgcgggcaccgcgtgctgatgatgctgccgaac
tgcgtgcagatctgggaggtgatgctcgcctcgatgaagctgggggcgtgcgtcatcccc
gccacgtcgctgctcacgcccgaggacgtccaggaccgcatcgagcgggggcgggtgggg
cacgtcatcaccgacgcggccggcaccgagaagttccgggtggtgaacgggaccttcacg
cggcacgtggtgggcgaggcggtgccgggctggatgcagtacgaggacgcctacgacgag
ggctcgttcttcctgccccacggcgagacgctggcctccgacccggtgctgctctacttc
acgagcggcaccaccgcgaagccgaagctggtggtgcacacgcacaagagctacccggtc
ggccacctctccacgatgtactggatcggcctccgcgagggcgacaagcacctcaacgtc
tcgtccccgggctgggcgaagcacgcctggtcgagcttcttcgcgccgttcaacgcgggc
gcgacggtctgcgtctacaactacgcccggttcagcgccgcccgcacgctggaggtgctg
gcgcgccaccagatcaccaccctgtgcgcgccgcccacggtgtggcgcatgctgatcctc
gaggacctggcgaagcacccggtgaagctccgagagctgctcagcgccggcgagccgctc
aacccggaggtcatcgagaaggtgcgccaggcctggggcatcaccatccgcgacggctac
ggccagaccgagaccacctgccagatcggcaactcgcccggccagccgctgaagcccggc
tccatgggccggccgctccccggctacaggatcgcgctgctcgacgaggaggggcgcccc
gcggccgaggagggcgagatctgcatcgacctcgaggcccggccggcctcgctcatggcg
ggctacgagggcgacgcgaacctgaacgacttcgtcacccggcacgggcactaccacacc
ggcgacgtcgccacccgcgacgaggagggctacatcacctacgtcgggcgctccgacgac
gtcttcaagagctcggactaccggatcagcccgttcgagctggagagcgcgctcatcgag
cacgacgcggtggccgaggcggcggtggtgccgagcccggacgcggtgcgcgggctcctg
cccaaggcgttcatcatcctgaagccggggcgcaccccggaccgcgagctggcgctcgag
atcttccggttcctgcggcgccgcctggccccgtacaagcgcatccgccgcctcgagttc
tccgagctgcccaagacggtgtcgggcaagatccggcgcgtcgagctgcggcgccgcgag
caggcgcgggcgccctcggcgccccggggcccgctcgagttctggcaggaggacttcccg
gagctggcggcgggcgaggggcgctga

DBGET integrated database retrieval system